Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C2WXX1

Protein Details
Accession A0A0C2WXX1   
Localization Confidence Low
Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
8-33RDVLPRAMRRRLKYTRQKPRLTQGSAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12, mito 9, cyto 5
Family & Domain DBs
Amino Acid Sequences MCEDLPRRDVLPRAMRRRLKYTRQKPRLTQGSALEVVYSTRWGGFKCRDERAVFCTFHLIRWRSQLIFTMMFVIPGEQRAEAGIMKTRGI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.69
3 0.7
4 0.76
5 0.76
6 0.77
7 0.78
8 0.8
9 0.82
10 0.84
11 0.86
12 0.82
13 0.83
14 0.81
15 0.74
16 0.67
17 0.58
18 0.53
19 0.46
20 0.4
21 0.3
22 0.21
23 0.17
24 0.13
25 0.1
26 0.06
27 0.06
28 0.06
29 0.07
30 0.11
31 0.16
32 0.23
33 0.26
34 0.29
35 0.32
36 0.33
37 0.34
38 0.36
39 0.36
40 0.29
41 0.25
42 0.3
43 0.26
44 0.27
45 0.33
46 0.3
47 0.26
48 0.31
49 0.34
50 0.28
51 0.29
52 0.29
53 0.26
54 0.25
55 0.24
56 0.22
57 0.19
58 0.19
59 0.18
60 0.15
61 0.11
62 0.12
63 0.13
64 0.09
65 0.09
66 0.1
67 0.11
68 0.11
69 0.13
70 0.17