Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C2X0F6

Protein Details
Accession A0A0C2X0F6    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
12-39GEYRHLKHAEKMERKRRKRMLSHYGYAEBasic
NLS Segment(s)
PositionSequence
20-30AEKMERKRRKR
Subcellular Location(s) nucl 20.5, cyto_nucl 13.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006616  DM9_repeat  
Pfam View protein in Pfam  
PF11901  DUF3421  
Amino Acid Sequences MGHSSSEDSDWGEYRHLKHAEKMERKRRKRMLSHYGYAESSHHGLIGDLNSHHGHHGGLMPNLTGRPDHYDHCGHYGHHGGRRPGGLVSLIGGVASALVGGHQRSRSAPPMPDMGYNNNQPGFPEARQYPAPGYPPPDRVQGSGPFLEPGYPPPRSFPEQRYTDDQFVPYNQSRSEDKSAGLPQQEYSAPPGPPPYTANPQSAPPSGFRVPLNTTTNFFPPPSDLGTPPCFDLDRSPLYFGSALFPRSVHPCKVGTHLGTHVLVAYGGREQTHSGRYDLLPFSPQTMELVRTSRGQIPPGRRPVEGGHEENEAKLYHAVATLQGVKVPGKTGSHLGGAIVGYEGEQLVVTDNYEILCWK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.34
3 0.39
4 0.38
5 0.43
6 0.52
7 0.58
8 0.64
9 0.71
10 0.74
11 0.79
12 0.85
13 0.89
14 0.89
15 0.89
16 0.89
17 0.89
18 0.89
19 0.87
20 0.85
21 0.8
22 0.73
23 0.63
24 0.54
25 0.45
26 0.37
27 0.3
28 0.23
29 0.17
30 0.14
31 0.14
32 0.15
33 0.15
34 0.14
35 0.12
36 0.15
37 0.16
38 0.16
39 0.17
40 0.15
41 0.13
42 0.12
43 0.16
44 0.16
45 0.17
46 0.17
47 0.17
48 0.18
49 0.18
50 0.17
51 0.13
52 0.12
53 0.17
54 0.19
55 0.2
56 0.24
57 0.28
58 0.29
59 0.32
60 0.32
61 0.26
62 0.27
63 0.33
64 0.32
65 0.34
66 0.38
67 0.35
68 0.37
69 0.38
70 0.35
71 0.28
72 0.25
73 0.2
74 0.14
75 0.13
76 0.1
77 0.09
78 0.07
79 0.07
80 0.05
81 0.04
82 0.04
83 0.03
84 0.02
85 0.02
86 0.04
87 0.05
88 0.08
89 0.09
90 0.1
91 0.12
92 0.16
93 0.21
94 0.24
95 0.26
96 0.25
97 0.29
98 0.3
99 0.31
100 0.3
101 0.3
102 0.31
103 0.31
104 0.31
105 0.28
106 0.26
107 0.23
108 0.24
109 0.23
110 0.18
111 0.22
112 0.19
113 0.22
114 0.23
115 0.24
116 0.22
117 0.21
118 0.23
119 0.19
120 0.24
121 0.24
122 0.28
123 0.28
124 0.31
125 0.3
126 0.28
127 0.3
128 0.29
129 0.28
130 0.25
131 0.23
132 0.19
133 0.18
134 0.17
135 0.14
136 0.15
137 0.16
138 0.17
139 0.17
140 0.19
141 0.23
142 0.26
143 0.3
144 0.31
145 0.35
146 0.37
147 0.4
148 0.44
149 0.44
150 0.43
151 0.39
152 0.35
153 0.27
154 0.24
155 0.27
156 0.22
157 0.2
158 0.17
159 0.19
160 0.19
161 0.23
162 0.27
163 0.22
164 0.21
165 0.23
166 0.24
167 0.24
168 0.23
169 0.19
170 0.15
171 0.16
172 0.16
173 0.13
174 0.15
175 0.16
176 0.15
177 0.15
178 0.18
179 0.16
180 0.17
181 0.19
182 0.19
183 0.22
184 0.25
185 0.27
186 0.26
187 0.27
188 0.29
189 0.28
190 0.25
191 0.19
192 0.22
193 0.2
194 0.22
195 0.2
196 0.2
197 0.21
198 0.26
199 0.29
200 0.25
201 0.25
202 0.25
203 0.27
204 0.25
205 0.22
206 0.17
207 0.15
208 0.15
209 0.17
210 0.17
211 0.16
212 0.19
213 0.21
214 0.21
215 0.2
216 0.19
217 0.16
218 0.15
219 0.17
220 0.17
221 0.19
222 0.19
223 0.21
224 0.2
225 0.21
226 0.21
227 0.18
228 0.17
229 0.15
230 0.15
231 0.13
232 0.13
233 0.14
234 0.2
235 0.24
236 0.22
237 0.23
238 0.24
239 0.26
240 0.31
241 0.33
242 0.27
243 0.26
244 0.26
245 0.26
246 0.24
247 0.22
248 0.17
249 0.13
250 0.12
251 0.09
252 0.08
253 0.06
254 0.07
255 0.07
256 0.08
257 0.1
258 0.13
259 0.17
260 0.18
261 0.18
262 0.21
263 0.21
264 0.26
265 0.25
266 0.23
267 0.21
268 0.2
269 0.22
270 0.19
271 0.19
272 0.15
273 0.16
274 0.17
275 0.17
276 0.19
277 0.18
278 0.2
279 0.22
280 0.27
281 0.28
282 0.31
283 0.35
284 0.42
285 0.49
286 0.57
287 0.57
288 0.5
289 0.51
290 0.49
291 0.51
292 0.49
293 0.43
294 0.35
295 0.37
296 0.37
297 0.34
298 0.33
299 0.24
300 0.19
301 0.16
302 0.15
303 0.11
304 0.11
305 0.11
306 0.1
307 0.14
308 0.15
309 0.15
310 0.15
311 0.16
312 0.17
313 0.17
314 0.19
315 0.19
316 0.17
317 0.2
318 0.22
319 0.23
320 0.24
321 0.23
322 0.21
323 0.19
324 0.17
325 0.15
326 0.11
327 0.08
328 0.07
329 0.07
330 0.07
331 0.05
332 0.05
333 0.05
334 0.07
335 0.08
336 0.08
337 0.08
338 0.09
339 0.09