Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C2SDH6

Protein Details
Accession A0A0C2SDH6    Localization Confidence Low Confidence Score 6.6
NoLS Segment(s)
PositionSequenceProtein Nature
8-29IISSKKVVTRRGTRRRTSARTAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17.5, cyto_mito 10.833, nucl 6.5, cyto_nucl 5.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR035979  RBD_domain_sf  
IPR000504  RRM_dom  
Gene Ontology GO:0003723  F:RNA binding  
Pfam View protein in Pfam  
PF00076  RRM_1  
PROSITE View protein in PROSITE  
PS50102  RRM  
Amino Acid Sequences MDKSLDDIISSKKVVTRRGTRRRTSARTAVLGNPTISPVTRARASAATTAPSNNAAEKIIISNLPIDVNEAQVKELFHSTVGPLKEVTLHYDSAGRSKGVASVHFQRKGDGTKAYQQYNNRLVDGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.39
3 0.45
4 0.53
5 0.63
6 0.72
7 0.75
8 0.81
9 0.84
10 0.82
11 0.79
12 0.77
13 0.71
14 0.65
15 0.61
16 0.54
17 0.48
18 0.43
19 0.35
20 0.27
21 0.22
22 0.2
23 0.17
24 0.16
25 0.13
26 0.15
27 0.16
28 0.16
29 0.17
30 0.18
31 0.2
32 0.2
33 0.19
34 0.17
35 0.16
36 0.16
37 0.15
38 0.14
39 0.13
40 0.1
41 0.1
42 0.09
43 0.08
44 0.08
45 0.08
46 0.07
47 0.07
48 0.06
49 0.06
50 0.06
51 0.06
52 0.06
53 0.07
54 0.06
55 0.08
56 0.09
57 0.09
58 0.09
59 0.1
60 0.1
61 0.09
62 0.1
63 0.09
64 0.08
65 0.08
66 0.08
67 0.12
68 0.12
69 0.12
70 0.11
71 0.11
72 0.13
73 0.13
74 0.17
75 0.15
76 0.15
77 0.15
78 0.18
79 0.18
80 0.19
81 0.2
82 0.16
83 0.14
84 0.14
85 0.17
86 0.15
87 0.17
88 0.18
89 0.27
90 0.35
91 0.4
92 0.4
93 0.38
94 0.41
95 0.44
96 0.43
97 0.38
98 0.35
99 0.39
100 0.45
101 0.48
102 0.5
103 0.51
104 0.56
105 0.58
106 0.56