Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C2SC25

Protein Details
Accession A0A0C2SC25    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
54-88KVKSQTPKVDKQEKKKTPKGRAKKRLLYNRRFVNVHydrophilic
NLS Segment(s)
PositionSequence
53-78GKVKSQTPKVDKQEKKKTPKGRAKKR
Subcellular Location(s) nucl 12.5, mito 10, cyto_nucl 9, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MPPRMNAIMRTLQNAETLNSRTVQLTESFASSHRVQLPQDNMGKVHGSLARAGKVKSQTPKVDKQEKKKTPKGRAKKRLLYNRRFVNVTTMQGGKRRM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.26
3 0.22
4 0.24
5 0.21
6 0.2
7 0.2
8 0.17
9 0.17
10 0.17
11 0.14
12 0.14
13 0.14
14 0.14
15 0.13
16 0.13
17 0.17
18 0.16
19 0.19
20 0.19
21 0.2
22 0.2
23 0.25
24 0.27
25 0.28
26 0.31
27 0.27
28 0.25
29 0.24
30 0.23
31 0.18
32 0.17
33 0.13
34 0.11
35 0.13
36 0.13
37 0.15
38 0.16
39 0.17
40 0.18
41 0.2
42 0.24
43 0.27
44 0.32
45 0.37
46 0.41
47 0.5
48 0.54
49 0.62
50 0.64
51 0.69
52 0.74
53 0.76
54 0.8
55 0.81
56 0.82
57 0.83
58 0.87
59 0.87
60 0.88
61 0.89
62 0.9
63 0.9
64 0.91
65 0.91
66 0.91
67 0.89
68 0.87
69 0.85
70 0.79
71 0.71
72 0.61
73 0.58
74 0.52
75 0.46
76 0.41
77 0.35
78 0.33