Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C2S407

Protein Details
Accession A0A0C2S407    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
76-102TGRMSFKERRPKNWRSRRPLTRQSTGTHydrophilic
NLS Segment(s)
PositionSequence
82-97KERRPKNWRSRRPLTR
Subcellular Location(s) nucl 9, mito 6.5, cyto_mito 6.5, cyto 5.5, extr 4
Family & Domain DBs
Amino Acid Sequences MPSNTRNHLAESHVGTTRAAIKADLVDRIIYNGTAVFKRLRIDQVDRNFVASLAPCAASFNVATEWCRGYQSFDGTGRMSFKERRPKNWRSRRPLTRQSTGTRRRGRCTILWCAYSTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.27
3 0.26
4 0.27
5 0.23
6 0.2
7 0.16
8 0.15
9 0.18
10 0.19
11 0.19
12 0.15
13 0.14
14 0.14
15 0.15
16 0.15
17 0.1
18 0.09
19 0.09
20 0.1
21 0.1
22 0.12
23 0.11
24 0.12
25 0.14
26 0.16
27 0.19
28 0.21
29 0.26
30 0.32
31 0.37
32 0.41
33 0.39
34 0.38
35 0.35
36 0.3
37 0.25
38 0.18
39 0.13
40 0.08
41 0.08
42 0.06
43 0.07
44 0.07
45 0.07
46 0.06
47 0.06
48 0.07
49 0.07
50 0.08
51 0.08
52 0.09
53 0.09
54 0.1
55 0.1
56 0.12
57 0.14
58 0.16
59 0.18
60 0.18
61 0.19
62 0.19
63 0.2
64 0.18
65 0.18
66 0.19
67 0.21
68 0.27
69 0.36
70 0.4
71 0.49
72 0.56
73 0.65
74 0.73
75 0.79
76 0.83
77 0.82
78 0.88
79 0.88
80 0.9
81 0.9
82 0.87
83 0.84
84 0.8
85 0.78
86 0.78
87 0.78
88 0.78
89 0.77
90 0.75
91 0.73
92 0.73
93 0.7
94 0.66
95 0.63
96 0.63
97 0.6
98 0.57