Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C2T4F6

Protein Details
Accession A0A0C2T4F6    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-44MAIKIVKKRTTKFKRHQSDRYHGVKEAWRKPKGIDNRVRRRFKGBasic
NLS Segment(s)
PositionSequence
7-50KKRTTKFKRHQSDRYHGVKEAWRKPKGIDNRVRRRFKGQTPMPK
Subcellular Location(s) nucl 12.5, mito_nucl 11, mito 8.5, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MAIKIVKKRTTKFKRHQSDRYHGVKEAWRKPKGIDNRVRRRFKGQTPMPKIGYGSNKKTRHLLPSGLKKFLVNNVREVDILLMHNKSFAAEIAHNVSSRNRTAILERAKVLGVKVTNPAARLRSEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.88
3 0.91
4 0.89
5 0.88
6 0.86
7 0.83
8 0.75
9 0.66
10 0.6
11 0.57
12 0.57
13 0.57
14 0.57
15 0.52
16 0.5
17 0.5
18 0.55
19 0.59
20 0.6
21 0.6
22 0.61
23 0.7
24 0.79
25 0.83
26 0.76
27 0.74
28 0.72
29 0.69
30 0.69
31 0.66
32 0.67
33 0.68
34 0.72
35 0.65
36 0.58
37 0.51
38 0.45
39 0.46
40 0.41
41 0.41
42 0.45
43 0.45
44 0.46
45 0.49
46 0.47
47 0.43
48 0.4
49 0.38
50 0.36
51 0.44
52 0.46
53 0.43
54 0.41
55 0.36
56 0.34
57 0.35
58 0.35
59 0.25
60 0.26
61 0.26
62 0.26
63 0.26
64 0.25
65 0.19
66 0.13
67 0.13
68 0.1
69 0.1
70 0.08
71 0.09
72 0.09
73 0.08
74 0.08
75 0.07
76 0.09
77 0.09
78 0.11
79 0.15
80 0.16
81 0.16
82 0.17
83 0.19
84 0.19
85 0.2
86 0.2
87 0.17
88 0.18
89 0.21
90 0.28
91 0.33
92 0.33
93 0.33
94 0.33
95 0.32
96 0.31
97 0.29
98 0.26
99 0.2
100 0.18
101 0.21
102 0.25
103 0.26
104 0.27
105 0.31
106 0.28