Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C2SU52

Protein Details
Accession A0A0C2SU52    Localization Confidence Low Confidence Score 8.5
NoLS Segment(s)
PositionSequenceProtein Nature
28-56SVKRCINWPWWQKPKRRTRTGYRTQPFHYHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, nucl 9
Family & Domain DBs
Amino Acid Sequences MLRLNSLYVILQDLLLRSSKYLLYPHVSVKRCINWPWWQKPKRRTRTGYRTQPFHYRTCWS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.11
3 0.1
4 0.09
5 0.1
6 0.1
7 0.11
8 0.13
9 0.15
10 0.17
11 0.19
12 0.25
13 0.31
14 0.32
15 0.32
16 0.34
17 0.35
18 0.34
19 0.34
20 0.32
21 0.34
22 0.41
23 0.49
24 0.57
25 0.6
26 0.66
27 0.75
28 0.81
29 0.82
30 0.83
31 0.81
32 0.82
33 0.86
34 0.88
35 0.89
36 0.86
37 0.82
38 0.76
39 0.78
40 0.72
41 0.65