Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C2WPA7

Protein Details
Accession A0A0C2WPA7   
Localization Confidence Medium
Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
13-34QPPLWRSPETKKKKTGPPRSTGHydrophilic
NLS Segment(s)
PositionSequence
23-32KKKKTGPPRS
Subcellular Location(s) nucl 13.5, cyto_nucl 10.5, mito 9, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013882  Ctp1_C  
Gene Ontology GO:0005634  C:nucleus  
GO:0006281  P:DNA repair  
Pfam View protein in Pfam  
PF08573  SAE2  
Amino Acid Sequences YYEVVGPLPSLVQPPLWRSPETKKKKTGPPRSTGQHKRHVSDSHAGIEDHKRLISRHRHHWARAVTPPGYWDIGFPSTQETEKINEKARSIERSSLRWIGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.26
3 0.29
4 0.3
5 0.32
6 0.42
7 0.5
8 0.58
9 0.61
10 0.63
11 0.68
12 0.77
13 0.83
14 0.84
15 0.81
16 0.77
17 0.77
18 0.76
19 0.78
20 0.78
21 0.74
22 0.73
23 0.68
24 0.64
25 0.62
26 0.57
27 0.5
28 0.46
29 0.4
30 0.33
31 0.3
32 0.27
33 0.24
34 0.24
35 0.21
36 0.16
37 0.14
38 0.13
39 0.12
40 0.2
41 0.28
42 0.31
43 0.39
44 0.48
45 0.52
46 0.53
47 0.61
48 0.57
49 0.51
50 0.51
51 0.46
52 0.37
53 0.33
54 0.32
55 0.26
56 0.24
57 0.19
58 0.14
59 0.13
60 0.14
61 0.14
62 0.13
63 0.14
64 0.15
65 0.15
66 0.16
67 0.15
68 0.17
69 0.24
70 0.28
71 0.32
72 0.34
73 0.34
74 0.4
75 0.44
76 0.47
77 0.45
78 0.49
79 0.45
80 0.46
81 0.52