Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B2WH89

Protein Details
Accession B2WH89    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
133-153KDSFKRCWKSYRERAWTKDQLHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 12, plas 7, mito 3, golg 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR012341  6hp_glycosidase-like_sf  
IPR001382  Glyco_hydro_47  
IPR036026  Seven-hairpin_glycosidases  
Gene Ontology GO:0016020  C:membrane  
GO:0005509  F:calcium ion binding  
GO:0004571  F:mannosyl-oligosaccharide 1,2-alpha-mannosidase activity  
GO:0005975  P:carbohydrate metabolic process  
GO:0006486  P:protein glycosylation  
GO:0030433  P:ubiquitin-dependent ERAD pathway  
Pfam View protein in Pfam  
PF01532  Glyco_hydro_47  
Amino Acid Sequences MFPRKWRWILALIAVMSLLGTMTLISNDSGPSRAALFPINYHEQTRRSTTKQSKLSAEQTRSSHACPTVPPNPALTPNTQNCFNWRAIPSHHPIDHYAQLPVGKPTARPPIQRKPSQGTIDKHVIDIRREAMKDSFKRCWKSYRERAWTKDQLAPTSGRSKDTQFGGWGATLVDSLDTLWIMDLKAQFAEAVDAALEIEFKPSDNCDSEINMFQIIIHYLGGFIGAYDVSGCHDARLLNKAVEVADMAYTSFDTPNRMPVSRWTLSVLIAEAASASVEFTCLSQITGDMRYFDAISRVTDVLDRQQGSTKLPGMWPISVDMRTPNLMFDKFFGLGAMADSAFEYLPKMHQLLNSAGPAAQYRKMYKYAMDTAIAHTLFRPMVHDQADILIASAKHDGPDGRRDDTGQHLVCYAGRMLALGRRLFDNATHIEIGRKISDGCAWTYKNAPSGIMPEVFSMTPCPSRLACDFIPGSSPFSAVHDSRYILRPEAVESIFYMFRLTGEAKYQDIAWDMFQAIETYTRTEFGNAALRNVTDAPPEQDDSMESFWLAETLKYFYLIFSDHDVISLDDFVFNTEAHLFRIP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.24
3 0.17
4 0.13
5 0.09
6 0.03
7 0.03
8 0.03
9 0.04
10 0.05
11 0.06
12 0.06
13 0.07
14 0.09
15 0.1
16 0.11
17 0.11
18 0.12
19 0.14
20 0.14
21 0.15
22 0.17
23 0.18
24 0.19
25 0.25
26 0.31
27 0.3
28 0.34
29 0.37
30 0.37
31 0.41
32 0.46
33 0.47
34 0.45
35 0.54
36 0.6
37 0.65
38 0.69
39 0.7
40 0.69
41 0.69
42 0.74
43 0.73
44 0.68
45 0.64
46 0.58
47 0.59
48 0.55
49 0.49
50 0.46
51 0.38
52 0.35
53 0.32
54 0.38
55 0.38
56 0.39
57 0.38
58 0.37
59 0.37
60 0.41
61 0.4
62 0.38
63 0.39
64 0.41
65 0.44
66 0.44
67 0.42
68 0.41
69 0.42
70 0.38
71 0.36
72 0.32
73 0.32
74 0.33
75 0.4
76 0.42
77 0.45
78 0.46
79 0.41
80 0.42
81 0.44
82 0.44
83 0.38
84 0.32
85 0.26
86 0.26
87 0.25
88 0.24
89 0.22
90 0.18
91 0.18
92 0.23
93 0.32
94 0.35
95 0.43
96 0.49
97 0.57
98 0.66
99 0.72
100 0.72
101 0.69
102 0.73
103 0.72
104 0.72
105 0.65
106 0.62
107 0.63
108 0.56
109 0.5
110 0.45
111 0.4
112 0.34
113 0.33
114 0.3
115 0.28
116 0.28
117 0.29
118 0.31
119 0.37
120 0.42
121 0.45
122 0.5
123 0.52
124 0.58
125 0.59
126 0.62
127 0.63
128 0.67
129 0.71
130 0.73
131 0.76
132 0.78
133 0.8
134 0.81
135 0.79
136 0.72
137 0.67
138 0.59
139 0.51
140 0.46
141 0.42
142 0.36
143 0.36
144 0.33
145 0.3
146 0.29
147 0.29
148 0.31
149 0.32
150 0.3
151 0.23
152 0.23
153 0.21
154 0.19
155 0.16
156 0.12
157 0.09
158 0.08
159 0.06
160 0.05
161 0.04
162 0.04
163 0.04
164 0.04
165 0.04
166 0.04
167 0.04
168 0.04
169 0.07
170 0.08
171 0.08
172 0.08
173 0.08
174 0.08
175 0.07
176 0.08
177 0.06
178 0.05
179 0.04
180 0.04
181 0.04
182 0.04
183 0.05
184 0.04
185 0.05
186 0.05
187 0.05
188 0.06
189 0.07
190 0.1
191 0.11
192 0.13
193 0.13
194 0.15
195 0.17
196 0.18
197 0.18
198 0.15
199 0.13
200 0.11
201 0.11
202 0.09
203 0.07
204 0.06
205 0.05
206 0.05
207 0.05
208 0.05
209 0.04
210 0.03
211 0.03
212 0.03
213 0.03
214 0.03
215 0.03
216 0.04
217 0.06
218 0.06
219 0.06
220 0.08
221 0.08
222 0.1
223 0.14
224 0.15
225 0.13
226 0.13
227 0.14
228 0.13
229 0.12
230 0.11
231 0.07
232 0.06
233 0.05
234 0.05
235 0.04
236 0.05
237 0.05
238 0.06
239 0.06
240 0.09
241 0.09
242 0.15
243 0.18
244 0.18
245 0.18
246 0.22
247 0.3
248 0.28
249 0.28
250 0.24
251 0.22
252 0.22
253 0.22
254 0.17
255 0.09
256 0.08
257 0.07
258 0.05
259 0.04
260 0.03
261 0.03
262 0.03
263 0.02
264 0.03
265 0.03
266 0.03
267 0.04
268 0.04
269 0.04
270 0.04
271 0.05
272 0.06
273 0.08
274 0.08
275 0.08
276 0.08
277 0.09
278 0.09
279 0.09
280 0.09
281 0.07
282 0.08
283 0.09
284 0.09
285 0.09
286 0.09
287 0.1
288 0.11
289 0.14
290 0.14
291 0.13
292 0.17
293 0.17
294 0.18
295 0.2
296 0.18
297 0.15
298 0.15
299 0.18
300 0.16
301 0.16
302 0.14
303 0.14
304 0.14
305 0.14
306 0.14
307 0.11
308 0.11
309 0.12
310 0.12
311 0.11
312 0.12
313 0.12
314 0.12
315 0.12
316 0.13
317 0.12
318 0.12
319 0.11
320 0.08
321 0.08
322 0.08
323 0.07
324 0.04
325 0.04
326 0.04
327 0.05
328 0.04
329 0.04
330 0.05
331 0.04
332 0.05
333 0.07
334 0.08
335 0.09
336 0.1
337 0.13
338 0.15
339 0.17
340 0.17
341 0.16
342 0.15
343 0.14
344 0.14
345 0.14
346 0.15
347 0.15
348 0.17
349 0.2
350 0.23
351 0.23
352 0.23
353 0.26
354 0.28
355 0.27
356 0.26
357 0.24
358 0.23
359 0.26
360 0.24
361 0.19
362 0.14
363 0.14
364 0.13
365 0.12
366 0.13
367 0.1
368 0.14
369 0.16
370 0.16
371 0.14
372 0.15
373 0.15
374 0.12
375 0.11
376 0.09
377 0.07
378 0.08
379 0.1
380 0.09
381 0.09
382 0.1
383 0.12
384 0.13
385 0.2
386 0.23
387 0.24
388 0.24
389 0.25
390 0.26
391 0.3
392 0.35
393 0.28
394 0.25
395 0.22
396 0.23
397 0.22
398 0.21
399 0.15
400 0.08
401 0.07
402 0.07
403 0.08
404 0.1
405 0.14
406 0.14
407 0.14
408 0.15
409 0.16
410 0.16
411 0.16
412 0.18
413 0.15
414 0.18
415 0.17
416 0.17
417 0.18
418 0.19
419 0.2
420 0.16
421 0.15
422 0.13
423 0.13
424 0.16
425 0.16
426 0.17
427 0.2
428 0.21
429 0.22
430 0.25
431 0.26
432 0.28
433 0.26
434 0.24
435 0.2
436 0.22
437 0.23
438 0.2
439 0.19
440 0.15
441 0.16
442 0.16
443 0.15
444 0.14
445 0.14
446 0.15
447 0.15
448 0.18
449 0.16
450 0.2
451 0.22
452 0.26
453 0.23
454 0.27
455 0.27
456 0.24
457 0.28
458 0.24
459 0.26
460 0.2
461 0.21
462 0.15
463 0.17
464 0.21
465 0.18
466 0.2
467 0.19
468 0.2
469 0.23
470 0.28
471 0.28
472 0.25
473 0.26
474 0.23
475 0.24
476 0.28
477 0.24
478 0.2
479 0.18
480 0.2
481 0.18
482 0.18
483 0.16
484 0.11
485 0.1
486 0.13
487 0.14
488 0.12
489 0.17
490 0.19
491 0.19
492 0.2
493 0.2
494 0.18
495 0.19
496 0.18
497 0.13
498 0.13
499 0.13
500 0.12
501 0.12
502 0.11
503 0.1
504 0.12
505 0.12
506 0.13
507 0.14
508 0.15
509 0.15
510 0.16
511 0.15
512 0.16
513 0.23
514 0.21
515 0.22
516 0.23
517 0.22
518 0.23
519 0.25
520 0.22
521 0.17
522 0.19
523 0.21
524 0.23
525 0.25
526 0.23
527 0.22
528 0.22
529 0.23
530 0.22
531 0.18
532 0.14
533 0.13
534 0.12
535 0.13
536 0.12
537 0.09
538 0.1
539 0.12
540 0.13
541 0.14
542 0.14
543 0.13
544 0.15
545 0.15
546 0.15
547 0.18
548 0.2
549 0.19
550 0.19
551 0.2
552 0.19
553 0.19
554 0.18
555 0.13
556 0.11
557 0.11
558 0.12
559 0.12
560 0.11
561 0.12
562 0.14
563 0.15