Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B2WGI0

Protein Details
Accession B2WGI0   
Localization Confidence High
Confidence Score 18
NoLS Segment(s)
PositionSequenceProtein Nature
1-33MSPMRTRAANKRQPDKKMPRKRGVKREDSPQQDHydrophilic
NLS Segment(s)
PositionSequence
8-26AANKRQPDKKMPRKRGVKR
Subcellular Location(s) nucl 25
Family & Domain DBs
Amino Acid Sequences MSPMRTRAANKRQPDKKMPRKRGVKREDSPQQDPISQDSLIPNIDDLAVFIDTYKKLQTDDQKAMDEEIELLRKEKSDLKEYNEELTARASLLANENPVLTKQVNELENDAKASEESLEEYKKRVKALADES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.84
3 0.84
4 0.87
5 0.88
6 0.88
7 0.9
8 0.92
9 0.92
10 0.9
11 0.9
12 0.83
13 0.83
14 0.82
15 0.79
16 0.73
17 0.68
18 0.6
19 0.52
20 0.48
21 0.41
22 0.34
23 0.27
24 0.23
25 0.18
26 0.17
27 0.15
28 0.14
29 0.11
30 0.08
31 0.08
32 0.06
33 0.06
34 0.06
35 0.05
36 0.05
37 0.05
38 0.07
39 0.07
40 0.09
41 0.09
42 0.08
43 0.09
44 0.14
45 0.22
46 0.26
47 0.31
48 0.32
49 0.32
50 0.32
51 0.31
52 0.27
53 0.19
54 0.13
55 0.09
56 0.09
57 0.07
58 0.08
59 0.08
60 0.08
61 0.1
62 0.15
63 0.17
64 0.23
65 0.26
66 0.31
67 0.37
68 0.38
69 0.39
70 0.35
71 0.32
72 0.25
73 0.23
74 0.18
75 0.11
76 0.11
77 0.09
78 0.08
79 0.11
80 0.11
81 0.11
82 0.11
83 0.11
84 0.11
85 0.11
86 0.14
87 0.11
88 0.1
89 0.12
90 0.17
91 0.19
92 0.19
93 0.22
94 0.22
95 0.22
96 0.22
97 0.2
98 0.15
99 0.13
100 0.13
101 0.1
102 0.08
103 0.11
104 0.14
105 0.19
106 0.19
107 0.23
108 0.29
109 0.31
110 0.32
111 0.33
112 0.33