Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C2S4I2

Protein Details
Accession A0A0C2S4I2    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
2-29MQTMTFKPRGWPPKRRTPKRPMNAFMIFHydrophilic
NLS Segment(s)
PositionSequence
10-21RGWPPKRRTPKR
Subcellular Location(s) mito_nucl 14, nucl 13, mito 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
Amino Acid Sequences MMQTMTFKPRGWPPKRRTPKRPMNAFMIFTRRCSPQMSAENQAMYTGELSKEWAMMPPSEKQFYLQLIAQNNLNKETFNSKYPDHVHRNNSRKMSNVDWILAWAGH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.8
3 0.86
4 0.87
5 0.87
6 0.89
7 0.89
8 0.91
9 0.84
10 0.81
11 0.75
12 0.68
13 0.6
14 0.57
15 0.47
16 0.4
17 0.39
18 0.32
19 0.29
20 0.29
21 0.28
22 0.28
23 0.35
24 0.36
25 0.37
26 0.36
27 0.35
28 0.31
29 0.29
30 0.21
31 0.14
32 0.1
33 0.07
34 0.06
35 0.05
36 0.07
37 0.07
38 0.07
39 0.07
40 0.08
41 0.08
42 0.08
43 0.1
44 0.13
45 0.16
46 0.17
47 0.17
48 0.16
49 0.18
50 0.18
51 0.18
52 0.16
53 0.17
54 0.18
55 0.19
56 0.2
57 0.21
58 0.21
59 0.21
60 0.19
61 0.16
62 0.16
63 0.21
64 0.21
65 0.22
66 0.25
67 0.23
68 0.3
69 0.35
70 0.42
71 0.45
72 0.5
73 0.55
74 0.62
75 0.69
76 0.71
77 0.72
78 0.66
79 0.63
80 0.6
81 0.56
82 0.54
83 0.49
84 0.42
85 0.36
86 0.35