Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C2S4G0

Protein Details
Accession A0A0C2S4G0   
Localization Confidence High
Confidence Score 15.9
NoLS Segment(s)
PositionSequenceProtein Nature
113-133GEEDKPKKRATKKKAASDDEGBasic
NLS Segment(s)
PositionSequence
117-127KPKKRATKKKA
Subcellular Location(s) nucl 23, mito 2, cyto 2, cyto_mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR001510  Znf_PARP  
IPR036957  Znf_PARP_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00645  zf-PARP  
PROSITE View protein in PROSITE  
PS50064  ZF_PARP_2  
Amino Acid Sequences MTDKQTGYRVEYANSSRAKCKGPKPCSGTSIQKEELRFGTLVDFRGATSFAWRHWGCVTPKILEKMKEMFSEPSDLDGYDDLKPEDQERIQKALEEGHVADEDIPDSARKVEGEEDKPKKRATKKKAASDDEGEEEIAEKPKKSRSTQAKVRVV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.39
3 0.37
4 0.4
5 0.45
6 0.46
7 0.52
8 0.55
9 0.57
10 0.64
11 0.66
12 0.67
13 0.65
14 0.64
15 0.65
16 0.6
17 0.6
18 0.55
19 0.52
20 0.47
21 0.46
22 0.41
23 0.34
24 0.28
25 0.21
26 0.2
27 0.19
28 0.19
29 0.17
30 0.16
31 0.13
32 0.14
33 0.14
34 0.09
35 0.12
36 0.12
37 0.11
38 0.2
39 0.19
40 0.2
41 0.21
42 0.27
43 0.24
44 0.29
45 0.31
46 0.25
47 0.29
48 0.32
49 0.34
50 0.3
51 0.3
52 0.28
53 0.29
54 0.27
55 0.26
56 0.23
57 0.2
58 0.21
59 0.18
60 0.16
61 0.14
62 0.12
63 0.11
64 0.1
65 0.11
66 0.09
67 0.1
68 0.08
69 0.08
70 0.09
71 0.09
72 0.11
73 0.11
74 0.16
75 0.18
76 0.21
77 0.2
78 0.2
79 0.2
80 0.2
81 0.19
82 0.15
83 0.13
84 0.11
85 0.11
86 0.1
87 0.1
88 0.08
89 0.07
90 0.06
91 0.06
92 0.05
93 0.06
94 0.06
95 0.07
96 0.07
97 0.08
98 0.13
99 0.19
100 0.26
101 0.35
102 0.43
103 0.48
104 0.52
105 0.54
106 0.58
107 0.61
108 0.66
109 0.66
110 0.69
111 0.72
112 0.79
113 0.86
114 0.83
115 0.79
116 0.73
117 0.67
118 0.6
119 0.51
120 0.4
121 0.3
122 0.25
123 0.21
124 0.23
125 0.2
126 0.18
127 0.21
128 0.29
129 0.36
130 0.4
131 0.48
132 0.53
133 0.62
134 0.71