Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C2WN26

Protein Details
Accession A0A0C2WN26   
Localization Confidence Low
Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
49-76MPVPICICKKNKKKRKQTSQPSLNEVKEHydrophilic
NLS Segment(s)
PositionSequence
58-65KNKKKRKQ
Subcellular Location(s) mito 15, nucl 3, cyto 3, cyto_nucl 3, pero 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MGRGASVDGTRARFRVKPLHTNFFDRGCSLSVGANNALRVLGLLSPVAMPVPICICKKNKKKRKQTSQPSLNEVKERKYRKLPAM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.37
3 0.4
4 0.47
5 0.52
6 0.6
7 0.59
8 0.62
9 0.61
10 0.54
11 0.48
12 0.38
13 0.33
14 0.24
15 0.22
16 0.16
17 0.15
18 0.13
19 0.13
20 0.14
21 0.13
22 0.12
23 0.11
24 0.1
25 0.08
26 0.07
27 0.06
28 0.05
29 0.04
30 0.04
31 0.04
32 0.04
33 0.04
34 0.04
35 0.03
36 0.03
37 0.03
38 0.06
39 0.1
40 0.11
41 0.15
42 0.21
43 0.32
44 0.42
45 0.53
46 0.62
47 0.68
48 0.79
49 0.87
50 0.92
51 0.93
52 0.94
53 0.94
54 0.94
55 0.89
56 0.85
57 0.81
58 0.73
59 0.7
60 0.62
61 0.58
62 0.57
63 0.57
64 0.58
65 0.61