Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C2WEH9

Protein Details
Accession A0A0C2WEH9    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-46MPVPKPRRDARAKKLLRFYVTLRRESERRKRRRVFRLRRIFRLTKLBasic
NLS Segment(s)
PositionSequence
5-42KPRRDARAKKLLRFYVTLRRESERRKRRRVFRLRRIFR
Subcellular Location(s) nucl 17.5, cyto_nucl 10, mito 8
Family & Domain DBs
Amino Acid Sequences MPVPKPRRDARAKKLLRFYVTLRRESERRKRRRVFRLRRIFRLTKLSSNARKSLSSLSSLSSISSSCDDESSSQSDEMSGLISSISSPSSISDLSELLSIGNGSDSDSSSSSGYGGDEESDFDSEMLDISDSDDGEELEESLDEGTGAERHGNNSVGLGSRWRRLRKWVSQQIMEMYAN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.81
3 0.74
4 0.67
5 0.63
6 0.62
7 0.59
8 0.56
9 0.5
10 0.49
11 0.52
12 0.58
13 0.64
14 0.64
15 0.69
16 0.75
17 0.81
18 0.86
19 0.9
20 0.91
21 0.92
22 0.92
23 0.93
24 0.9
25 0.89
26 0.88
27 0.81
28 0.75
29 0.73
30 0.66
31 0.61
32 0.59
33 0.59
34 0.58
35 0.58
36 0.57
37 0.5
38 0.47
39 0.42
40 0.41
41 0.34
42 0.29
43 0.25
44 0.22
45 0.21
46 0.2
47 0.19
48 0.13
49 0.12
50 0.1
51 0.1
52 0.1
53 0.09
54 0.09
55 0.09
56 0.1
57 0.12
58 0.13
59 0.13
60 0.12
61 0.12
62 0.12
63 0.11
64 0.1
65 0.08
66 0.05
67 0.04
68 0.04
69 0.04
70 0.04
71 0.04
72 0.04
73 0.03
74 0.04
75 0.04
76 0.05
77 0.05
78 0.06
79 0.06
80 0.06
81 0.06
82 0.06
83 0.06
84 0.05
85 0.05
86 0.04
87 0.04
88 0.04
89 0.03
90 0.04
91 0.04
92 0.05
93 0.06
94 0.07
95 0.08
96 0.08
97 0.08
98 0.08
99 0.07
100 0.07
101 0.06
102 0.06
103 0.05
104 0.05
105 0.06
106 0.07
107 0.08
108 0.08
109 0.07
110 0.07
111 0.06
112 0.06
113 0.05
114 0.05
115 0.04
116 0.05
117 0.06
118 0.06
119 0.06
120 0.06
121 0.06
122 0.06
123 0.06
124 0.05
125 0.05
126 0.05
127 0.05
128 0.05
129 0.05
130 0.04
131 0.04
132 0.05
133 0.05
134 0.06
135 0.09
136 0.1
137 0.12
138 0.14
139 0.15
140 0.14
141 0.15
142 0.16
143 0.14
144 0.14
145 0.2
146 0.2
147 0.26
148 0.35
149 0.4
150 0.42
151 0.5
152 0.6
153 0.63
154 0.71
155 0.75
156 0.75
157 0.73
158 0.74
159 0.68