Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C2WBX5

Protein Details
Accession A0A0C2WBX5    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
35-54QFSPRRRDVRRVRAHDRLQNHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 10, plas 5, cyto 4, extr 3, cyto_nucl 3, cyto_pero 3
Family & Domain DBs
Amino Acid Sequences MPRFLVRLVPVETLTLGIMAWLPSNAFKFSYISHQFSPRRRDVRRVRAHDRLQN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.1
3 0.07
4 0.05
5 0.05
6 0.05
7 0.05
8 0.04
9 0.04
10 0.06
11 0.07
12 0.08
13 0.08
14 0.08
15 0.09
16 0.1
17 0.19
18 0.22
19 0.25
20 0.26
21 0.34
22 0.39
23 0.45
24 0.52
25 0.53
26 0.57
27 0.57
28 0.66
29 0.68
30 0.74
31 0.78
32 0.79
33 0.79
34 0.8