Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C2W948

Protein Details
Accession A0A0C2W948   
Localization Confidence Low
Confidence Score 7.8
NoLS Segment(s)
PositionSequenceProtein Nature
14-43ASLQVKKIRSRWSRFCRNHRCARRSRHLILHydrophilic
NLS Segment(s)
Subcellular Location(s) mito_nucl 13.333, nucl 13, mito 12.5, cyto_nucl 7.833
Family & Domain DBs
Amino Acid Sequences MRVLQNRWLKQGSASLQVKKIRSRWSRFCRNHRCARRSRHLILNYMALTQRPVDFHVYAAAGDSQKGKQERRTTVARSAVSTLQFYCLTSARTCNRNNLVN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.4
3 0.44
4 0.49
5 0.5
6 0.49
7 0.51
8 0.52
9 0.56
10 0.61
11 0.65
12 0.7
13 0.77
14 0.81
15 0.86
16 0.87
17 0.86
18 0.88
19 0.88
20 0.86
21 0.84
22 0.84
23 0.83
24 0.8
25 0.76
26 0.74
27 0.67
28 0.62
29 0.54
30 0.49
31 0.38
32 0.31
33 0.27
34 0.18
35 0.15
36 0.12
37 0.11
38 0.08
39 0.09
40 0.11
41 0.11
42 0.11
43 0.12
44 0.11
45 0.1
46 0.1
47 0.1
48 0.07
49 0.08
50 0.09
51 0.09
52 0.14
53 0.18
54 0.2
55 0.26
56 0.34
57 0.39
58 0.43
59 0.49
60 0.48
61 0.51
62 0.56
63 0.49
64 0.43
65 0.41
66 0.39
67 0.34
68 0.31
69 0.24
70 0.21
71 0.2
72 0.18
73 0.18
74 0.16
75 0.18
76 0.18
77 0.25
78 0.28
79 0.35
80 0.37
81 0.44