Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C2TEV2

Protein Details
Accession A0A0C2TEV2    Localization Confidence High Confidence Score 16.1
NoLS Segment(s)
PositionSequenceProtein Nature
13-46SSGRLKKVIKARRSQQQQHRRKQGRKRDTQVHDEHydrophilic
NLS Segment(s)
PositionSequence
7-39STKKFASSGRLKKVIKARRSQQQQHRRKQGRKR
Subcellular Location(s) nucl 22, mito 5
Family & Domain DBs
Amino Acid Sequences MGKTAKSTKKFASSGRLKKVIKARRSQQQQHRRKQGRKRDTQVHDEVESQDAPPKRAEKAKKMTVDDLLSGKFMEADVDDMSEDEVDLEGSDEEEEGASSDEMSQIADDESFASVDELEGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.68
3 0.71
4 0.63
5 0.66
6 0.71
7 0.7
8 0.68
9 0.68
10 0.67
11 0.68
12 0.77
13 0.8
14 0.81
15 0.83
16 0.85
17 0.86
18 0.89
19 0.89
20 0.88
21 0.89
22 0.89
23 0.89
24 0.89
25 0.86
26 0.85
27 0.81
28 0.79
29 0.75
30 0.67
31 0.57
32 0.48
33 0.41
34 0.32
35 0.27
36 0.19
37 0.19
38 0.16
39 0.16
40 0.17
41 0.17
42 0.18
43 0.25
44 0.3
45 0.34
46 0.41
47 0.46
48 0.49
49 0.5
50 0.49
51 0.45
52 0.41
53 0.33
54 0.26
55 0.2
56 0.15
57 0.13
58 0.11
59 0.08
60 0.07
61 0.06
62 0.04
63 0.05
64 0.05
65 0.06
66 0.06
67 0.06
68 0.06
69 0.05
70 0.05
71 0.04
72 0.04
73 0.04
74 0.04
75 0.04
76 0.04
77 0.05
78 0.05
79 0.04
80 0.05
81 0.05
82 0.05
83 0.04
84 0.06
85 0.05
86 0.06
87 0.06
88 0.06
89 0.07
90 0.07
91 0.06
92 0.06
93 0.06
94 0.06
95 0.06
96 0.06
97 0.07
98 0.07
99 0.07
100 0.07
101 0.06