Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C2RXN3

Protein Details
Accession A0A0C2RXN3    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
2-36DEKGCQRGGGRKNSNRKYFVHRSRRPKYRARSGNLHydrophilic
NLS Segment(s)
PositionSequence
12-30RKNSNRKYFVHRSRRPKYR
Subcellular Location(s) nucl 13, cyto_nucl 9.5, mito 7, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR004875  DDE_SF_endonuclease_dom  
Gene Ontology GO:0003676  F:nucleic acid binding  
Pfam View protein in Pfam  
PF03184  DDE_1  
Amino Acid Sequences MDEKGCQRGGGRKNSNRKYFVHRSRRPKYRARSGNLELVTIIECVCADGTYLLPGFVFSGKEFAQEWFEVDRNIGVSMSENGWTDDFLCKEWFKNSFIPQTIAQNTSGKPILLI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.82
3 0.77
4 0.73
5 0.72
6 0.72
7 0.74
8 0.74
9 0.74
10 0.76
11 0.82
12 0.88
13 0.85
14 0.84
15 0.83
16 0.83
17 0.83
18 0.78
19 0.77
20 0.7
21 0.7
22 0.61
23 0.51
24 0.4
25 0.32
26 0.26
27 0.17
28 0.13
29 0.06
30 0.05
31 0.05
32 0.05
33 0.04
34 0.04
35 0.04
36 0.04
37 0.05
38 0.05
39 0.05
40 0.04
41 0.05
42 0.05
43 0.05
44 0.06
45 0.05
46 0.07
47 0.07
48 0.09
49 0.09
50 0.1
51 0.11
52 0.11
53 0.12
54 0.12
55 0.12
56 0.11
57 0.11
58 0.11
59 0.09
60 0.09
61 0.08
62 0.06
63 0.07
64 0.08
65 0.08
66 0.09
67 0.09
68 0.1
69 0.1
70 0.1
71 0.1
72 0.12
73 0.12
74 0.12
75 0.15
76 0.15
77 0.17
78 0.21
79 0.23
80 0.23
81 0.29
82 0.33
83 0.38
84 0.39
85 0.41
86 0.39
87 0.44
88 0.44
89 0.39
90 0.36
91 0.33
92 0.31
93 0.33
94 0.32