Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C2X8A1

Protein Details
Accession A0A0C2X8A1    Localization Confidence High Confidence Score 17.4
NoLS Segment(s)
PositionSequenceProtein Nature
28-78QPKPESAPKKATKPRAKKAEKQEGEDKEKEEKPKPSRGKKRKESEEPNGASBasic
NLS Segment(s)
PositionSequence
20-76RRSSRIKVQPKPESAPKKATKPRAKKAEKQEGEDKEKEEKPKPSRGKKRKESEEPNG
83-135EEPVAKKAKPASKAKEGTSKPPSTVAKPSSKASAKPVSKAASKPPSRAGSRKP
Subcellular Location(s) nucl 20, mito 7
Family & Domain DBs
Amino Acid Sequences MPRKAAAAAPTSTDSSVEPRRSSRIKVQPKPESAPKKATKPRAKKAEKQEGEDKEKEEKPKPSRGKKRKESEEPNGASAEGEEEPVAKKAKPASKAKEGTSKPPSTVAKPSSKASAKPVSKAASKPPSRAGSRKPVSKVVVEGQSTEAAQASPNVDTIAEEPEVEAQADDGEAPEEPASPEEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.22
3 0.29
4 0.3
5 0.31
6 0.32
7 0.4
8 0.43
9 0.48
10 0.51
11 0.54
12 0.6
13 0.66
14 0.73
15 0.75
16 0.77
17 0.78
18 0.78
19 0.76
20 0.7
21 0.72
22 0.68
23 0.69
24 0.71
25 0.75
26 0.76
27 0.77
28 0.82
29 0.83
30 0.85
31 0.83
32 0.86
33 0.86
34 0.79
35 0.75
36 0.74
37 0.71
38 0.7
39 0.64
40 0.55
41 0.51
42 0.51
43 0.5
44 0.48
45 0.49
46 0.47
47 0.55
48 0.63
49 0.67
50 0.74
51 0.79
52 0.83
53 0.84
54 0.89
55 0.89
56 0.89
57 0.87
58 0.84
59 0.83
60 0.74
61 0.65
62 0.55
63 0.45
64 0.34
65 0.25
66 0.19
67 0.09
68 0.07
69 0.06
70 0.06
71 0.06
72 0.08
73 0.1
74 0.08
75 0.09
76 0.15
77 0.2
78 0.26
79 0.33
80 0.37
81 0.45
82 0.48
83 0.49
84 0.53
85 0.5
86 0.51
87 0.51
88 0.46
89 0.37
90 0.4
91 0.4
92 0.33
93 0.39
94 0.36
95 0.35
96 0.36
97 0.37
98 0.38
99 0.38
100 0.37
101 0.37
102 0.41
103 0.36
104 0.36
105 0.4
106 0.36
107 0.38
108 0.38
109 0.41
110 0.41
111 0.42
112 0.42
113 0.45
114 0.48
115 0.5
116 0.53
117 0.51
118 0.52
119 0.56
120 0.6
121 0.56
122 0.56
123 0.54
124 0.5
125 0.47
126 0.41
127 0.41
128 0.34
129 0.32
130 0.27
131 0.25
132 0.23
133 0.2
134 0.15
135 0.09
136 0.09
137 0.1
138 0.09
139 0.08
140 0.09
141 0.09
142 0.08
143 0.09
144 0.1
145 0.12
146 0.11
147 0.1
148 0.1
149 0.11
150 0.12
151 0.11
152 0.1
153 0.07
154 0.07
155 0.07
156 0.07
157 0.06
158 0.06
159 0.06
160 0.07
161 0.07
162 0.08
163 0.09