Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C2XGT2

Protein Details
Accession A0A0C2XGT2    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MAIHIKKLKVRPRKNAANNICGSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23, cyto_mito 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR017264  Ribosomal_MRP10_mt  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
PROSITE View protein in PROSITE  
PS51257  PROKAR_LIPOPROTEIN  
Amino Acid Sequences MAIHIKKLKVRPRKNAANNICGSQLATLLACWAASGDLHSNTKSCADATAALFTCMRTTPMSKGFQKPAINYHLGRLGKTIQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.87
3 0.84
4 0.82
5 0.74
6 0.65
7 0.55
8 0.44
9 0.35
10 0.24
11 0.18
12 0.1
13 0.08
14 0.06
15 0.06
16 0.06
17 0.05
18 0.04
19 0.04
20 0.03
21 0.03
22 0.05
23 0.06
24 0.08
25 0.09
26 0.1
27 0.1
28 0.1
29 0.11
30 0.1
31 0.08
32 0.07
33 0.07
34 0.09
35 0.1
36 0.14
37 0.13
38 0.14
39 0.14
40 0.13
41 0.13
42 0.11
43 0.12
44 0.1
45 0.12
46 0.16
47 0.22
48 0.29
49 0.33
50 0.39
51 0.43
52 0.49
53 0.5
54 0.48
55 0.48
56 0.47
57 0.47
58 0.41
59 0.39
60 0.4
61 0.37
62 0.35