Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C2XFW7

Protein Details
Accession A0A0C2XFW7    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
39-61SFWDRWNRGKQWKDIRHRYIQEEHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 13, mito 9, cyto 2, vacu 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR008027  QCR9  
IPR036656  QCR9_sf  
Gene Ontology GO:0005750  C:mitochondrial respiratory chain complex III  
GO:0006122  P:mitochondrial electron transport, ubiquinol to cytochrome c  
Pfam View protein in Pfam  
PF05365  UCR_UQCRX_QCR9  
Amino Acid Sequences MSFANTAYNTIFKRNSVFVTTTFLGAFAFGMGFDLAVTSFWDRWNRGKQWKDIRHRYIQEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.27
3 0.25
4 0.26
5 0.21
6 0.26
7 0.25
8 0.23
9 0.2
10 0.17
11 0.14
12 0.12
13 0.11
14 0.04
15 0.04
16 0.03
17 0.03
18 0.03
19 0.03
20 0.03
21 0.03
22 0.03
23 0.03
24 0.05
25 0.05
26 0.06
27 0.09
28 0.13
29 0.16
30 0.23
31 0.31
32 0.38
33 0.46
34 0.53
35 0.59
36 0.67
37 0.75
38 0.79
39 0.81
40 0.81
41 0.82