Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C2TJG3

Protein Details
Accession A0A0C2TJG3   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
102-126PGGKAERVKRRLDNKQRIKERNFMSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 26
Family & Domain DBs
InterPro View protein in InterPro  
IPR013870  Ribosomal_L37_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08561  Ribosomal_L37  
Amino Acid Sequences MSFFRLQTGFAVCSRCRRYATKAGAQVNISAAASSAASAKVAKKPSASRTTAIPQSSCPADTILTGVNYLKGQPPVLALPEDQYPEWLWTILESKVYPDDGPGGKAERVKRRLDNKQRIKERNFMSTQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.39
3 0.4
4 0.42
5 0.48
6 0.52
7 0.59
8 0.58
9 0.61
10 0.61
11 0.6
12 0.56
13 0.48
14 0.39
15 0.32
16 0.23
17 0.15
18 0.11
19 0.08
20 0.07
21 0.06
22 0.06
23 0.05
24 0.06
25 0.07
26 0.09
27 0.14
28 0.17
29 0.18
30 0.21
31 0.26
32 0.34
33 0.4
34 0.4
35 0.36
36 0.37
37 0.41
38 0.42
39 0.38
40 0.31
41 0.24
42 0.24
43 0.23
44 0.2
45 0.15
46 0.11
47 0.1
48 0.09
49 0.09
50 0.08
51 0.07
52 0.07
53 0.07
54 0.07
55 0.07
56 0.07
57 0.09
58 0.08
59 0.08
60 0.08
61 0.1
62 0.09
63 0.11
64 0.11
65 0.09
66 0.1
67 0.11
68 0.12
69 0.11
70 0.11
71 0.11
72 0.11
73 0.12
74 0.1
75 0.09
76 0.09
77 0.11
78 0.1
79 0.11
80 0.1
81 0.11
82 0.13
83 0.14
84 0.13
85 0.11
86 0.16
87 0.15
88 0.16
89 0.16
90 0.18
91 0.19
92 0.24
93 0.31
94 0.36
95 0.41
96 0.46
97 0.54
98 0.6
99 0.69
100 0.76
101 0.8
102 0.81
103 0.86
104 0.9
105 0.91
106 0.86
107 0.84
108 0.78