Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C2X9V4

Protein Details
Accession A0A0C2X9V4    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
41-62LTVKAGCSKRRKVKGKLDEEPAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22.5, cyto_mito 13, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MNLMPLPRNRWATSKLTLISCRGWVVTTRLCIVVVSTHEVLTVKAGCSKRRKVKGKLDEEPAPRGGISVICTC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.41
3 0.39
4 0.39
5 0.37
6 0.34
7 0.29
8 0.26
9 0.2
10 0.18
11 0.16
12 0.18
13 0.18
14 0.18
15 0.18
16 0.17
17 0.17
18 0.16
19 0.14
20 0.12
21 0.1
22 0.11
23 0.11
24 0.1
25 0.1
26 0.11
27 0.1
28 0.1
29 0.1
30 0.07
31 0.13
32 0.15
33 0.21
34 0.29
35 0.39
36 0.47
37 0.56
38 0.65
39 0.69
40 0.78
41 0.82
42 0.84
43 0.82
44 0.79
45 0.77
46 0.72
47 0.66
48 0.57
49 0.47
50 0.37
51 0.3
52 0.24
53 0.17