Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B2WD15

Protein Details
Accession B2WD15    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
6-27DIDFTRRNKKPRPLSEHEKEKLBasic
NLS Segment(s)
Subcellular Location(s) nucl 22, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR000789  Cyclin-dep_kinase_reg-sub  
IPR036858  Cyclin-dep_kinase_reg-sub_sf  
Gene Ontology GO:0016538  F:cyclin-dependent protein serine/threonine kinase regulator activity  
GO:0007049  P:cell cycle  
GO:0051301  P:cell division  
Pfam View protein in Pfam  
PF01111  CKS  
PROSITE View protein in PROSITE  
PS00944  CKS_1  
Amino Acid Sequences MSAELDIDFTRRNKKPRPLSEHEKEKLDEFVDAIHYSARYSDDAYEYRHVQLPKQM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.65
3 0.72
4 0.78
5 0.78
6 0.81
7 0.83
8 0.83
9 0.76
10 0.68
11 0.59
12 0.5
13 0.43
14 0.34
15 0.24
16 0.14
17 0.12
18 0.1
19 0.1
20 0.09
21 0.08
22 0.07
23 0.07
24 0.08
25 0.09
26 0.08
27 0.09
28 0.11
29 0.14
30 0.16
31 0.2
32 0.23
33 0.24
34 0.26
35 0.3
36 0.29