Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C2WF38

Protein Details
Accession A0A0C2WF38    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
71-101REKIRTGKLPARQRKMRKDKGTTRRRKSAIGBasic
NLS Segment(s)
PositionSequence
70-97HREKIRTGKLPARQRKMRKDKGTTRRRK
Subcellular Location(s) nucl 16, cyto_nucl 12.5, cysk 6, cyto 5
Family & Domain DBs
Amino Acid Sequences ATMQYARYEEDIIHRYGVELVGWTFDKIVNPSQLSSSIGPLRELHDALKGGSCKFIQLEASEVKMRIATHREKIRTGKLPARQRKMRKDKGTTRRRKSAIGVTEDDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.19
3 0.19
4 0.18
5 0.11
6 0.09
7 0.08
8 0.1
9 0.1
10 0.1
11 0.09
12 0.1
13 0.12
14 0.13
15 0.16
16 0.18
17 0.18
18 0.19
19 0.19
20 0.19
21 0.2
22 0.19
23 0.19
24 0.17
25 0.16
26 0.17
27 0.16
28 0.17
29 0.16
30 0.16
31 0.14
32 0.13
33 0.13
34 0.13
35 0.15
36 0.14
37 0.12
38 0.13
39 0.13
40 0.11
41 0.11
42 0.11
43 0.09
44 0.08
45 0.11
46 0.1
47 0.12
48 0.13
49 0.13
50 0.12
51 0.13
52 0.13
53 0.13
54 0.18
55 0.2
56 0.27
57 0.34
58 0.36
59 0.39
60 0.44
61 0.49
62 0.51
63 0.52
64 0.52
65 0.53
66 0.62
67 0.67
68 0.72
69 0.74
70 0.76
71 0.81
72 0.85
73 0.87
74 0.86
75 0.87
76 0.88
77 0.9
78 0.91
79 0.91
80 0.89
81 0.89
82 0.83
83 0.77
84 0.73
85 0.72
86 0.69
87 0.64