Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C2WF26

Protein Details
Accession A0A0C2WF26    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
11-33VDPLAQKVKPKPKPKTRVPLVSAHydrophilic
NLS Segment(s)
PositionSequence
19-25KPKPKPK
Subcellular Location(s) cyto 16, cyto_nucl 11, mito 7, nucl 4
Family & Domain DBs
Amino Acid Sequences MDGIHGMPPIVDPLAQKVKPKPKPKTRVPLVSASSVANAMVNPSGIDNINYTPPSLAPNAPRAPSPVLDAVLSPI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.25
3 0.29
4 0.36
5 0.47
6 0.55
7 0.64
8 0.68
9 0.71
10 0.79
11 0.84
12 0.86
13 0.84
14 0.84
15 0.77
16 0.74
17 0.66
18 0.58
19 0.49
20 0.38
21 0.3
22 0.21
23 0.17
24 0.09
25 0.07
26 0.05
27 0.04
28 0.04
29 0.04
30 0.04
31 0.05
32 0.05
33 0.06
34 0.07
35 0.08
36 0.11
37 0.11
38 0.11
39 0.1
40 0.11
41 0.12
42 0.14
43 0.16
44 0.16
45 0.23
46 0.27
47 0.28
48 0.28
49 0.29
50 0.31
51 0.29
52 0.3
53 0.25
54 0.23
55 0.22