Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C2XNN5

Protein Details
Accession A0A0C2XNN5    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
5-30QDSPLRPSTCCRRKKNNPGQRRDGAPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, cyto_nucl 9.5, mito 9
Family & Domain DBs
Amino Acid Sequences MASIQDSPLRPSTCCRRKKNNPGQRRDGAPINSTLHFPMSFRTCGAISWLTDRAADNRTPALKPVVLA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.61
3 0.65
4 0.75
5 0.85
6 0.9
7 0.89
8 0.9
9 0.89
10 0.88
11 0.82
12 0.75
13 0.67
14 0.61
15 0.53
16 0.44
17 0.38
18 0.32
19 0.28
20 0.24
21 0.2
22 0.16
23 0.14
24 0.12
25 0.12
26 0.13
27 0.13
28 0.12
29 0.14
30 0.13
31 0.13
32 0.17
33 0.16
34 0.13
35 0.16
36 0.18
37 0.16
38 0.17
39 0.18
40 0.18
41 0.19
42 0.2
43 0.18
44 0.22
45 0.25
46 0.25
47 0.26
48 0.28