Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C2SNG7

Protein Details
Accession A0A0C2SNG7    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
8-38LPENIQRRPLRGHRHRPKKDKKVSESGTFTPBasic
NLS Segment(s)
PositionSequence
14-29RRPLRGHRHRPKKDKK
Subcellular Location(s) nucl 16, cyto 7, mito 4
Family & Domain DBs
Amino Acid Sequences MYRNYLMLPENIQRRPLRGHRHRPKKDKKVSESGTFTPISRAGCRALGETKVETATANNAKKAEEKTGVDLFKFIKKLNKTSAPQPSLLGGEPTESKASPVLMVTNDQDASGRLPSHASQLTCMYEPMDTTLDVTQGPIFRFVPQEPHIFDPPGLAQYFAPRQAQFELGVMLHPPMYQAFQPLEHQHFVDQDQRLRPPIHMYPIDQQFHRRVDFVRNHVHPHLQANNHPAMEGYFPIVPHVDIGHAIHQYPDVSTPLQPTIIHDEPVDRQFMFYPPAHEELVNQLHIPPLVNEMVGHNDRITYRHMGDAGELAHDAHLGNHRFFMNAEAREPGHAGLFDEMFGIVNFDEDDNDHDNDDEQLEVVA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.5
3 0.55
4 0.59
5 0.62
6 0.71
7 0.75
8 0.85
9 0.91
10 0.93
11 0.95
12 0.95
13 0.95
14 0.94
15 0.92
16 0.92
17 0.88
18 0.85
19 0.8
20 0.72
21 0.66
22 0.56
23 0.47
24 0.39
25 0.36
26 0.3
27 0.26
28 0.25
29 0.23
30 0.24
31 0.25
32 0.25
33 0.26
34 0.25
35 0.26
36 0.25
37 0.24
38 0.22
39 0.21
40 0.18
41 0.16
42 0.21
43 0.26
44 0.27
45 0.28
46 0.29
47 0.3
48 0.34
49 0.36
50 0.34
51 0.32
52 0.31
53 0.34
54 0.4
55 0.4
56 0.35
57 0.35
58 0.31
59 0.3
60 0.3
61 0.27
62 0.28
63 0.32
64 0.38
65 0.44
66 0.51
67 0.49
68 0.56
69 0.65
70 0.6
71 0.56
72 0.5
73 0.43
74 0.36
75 0.33
76 0.25
77 0.15
78 0.13
79 0.13
80 0.14
81 0.14
82 0.12
83 0.12
84 0.12
85 0.12
86 0.11
87 0.1
88 0.1
89 0.1
90 0.11
91 0.12
92 0.13
93 0.13
94 0.12
95 0.12
96 0.11
97 0.12
98 0.12
99 0.11
100 0.09
101 0.11
102 0.12
103 0.16
104 0.19
105 0.17
106 0.17
107 0.19
108 0.21
109 0.19
110 0.19
111 0.14
112 0.11
113 0.11
114 0.12
115 0.1
116 0.08
117 0.09
118 0.09
119 0.1
120 0.09
121 0.1
122 0.09
123 0.1
124 0.11
125 0.12
126 0.12
127 0.12
128 0.15
129 0.15
130 0.19
131 0.2
132 0.23
133 0.22
134 0.26
135 0.26
136 0.24
137 0.24
138 0.19
139 0.17
140 0.16
141 0.14
142 0.11
143 0.09
144 0.12
145 0.14
146 0.15
147 0.17
148 0.14
149 0.16
150 0.16
151 0.17
152 0.14
153 0.13
154 0.11
155 0.09
156 0.09
157 0.08
158 0.07
159 0.06
160 0.05
161 0.05
162 0.05
163 0.06
164 0.06
165 0.07
166 0.08
167 0.08
168 0.11
169 0.13
170 0.16
171 0.16
172 0.16
173 0.14
174 0.15
175 0.16
176 0.19
177 0.18
178 0.19
179 0.21
180 0.22
181 0.24
182 0.24
183 0.23
184 0.22
185 0.23
186 0.24
187 0.23
188 0.25
189 0.28
190 0.34
191 0.36
192 0.31
193 0.32
194 0.32
195 0.33
196 0.32
197 0.26
198 0.21
199 0.28
200 0.33
201 0.35
202 0.38
203 0.37
204 0.4
205 0.41
206 0.41
207 0.34
208 0.34
209 0.34
210 0.28
211 0.29
212 0.3
213 0.31
214 0.29
215 0.27
216 0.22
217 0.18
218 0.16
219 0.13
220 0.1
221 0.08
222 0.08
223 0.09
224 0.09
225 0.08
226 0.08
227 0.08
228 0.07
229 0.06
230 0.07
231 0.1
232 0.1
233 0.1
234 0.1
235 0.1
236 0.1
237 0.1
238 0.1
239 0.09
240 0.1
241 0.11
242 0.13
243 0.13
244 0.14
245 0.14
246 0.15
247 0.22
248 0.22
249 0.22
250 0.2
251 0.21
252 0.23
253 0.25
254 0.24
255 0.15
256 0.15
257 0.16
258 0.17
259 0.19
260 0.17
261 0.19
262 0.2
263 0.23
264 0.23
265 0.21
266 0.21
267 0.23
268 0.25
269 0.23
270 0.2
271 0.17
272 0.17
273 0.18
274 0.18
275 0.11
276 0.11
277 0.11
278 0.11
279 0.11
280 0.11
281 0.17
282 0.18
283 0.18
284 0.15
285 0.16
286 0.17
287 0.18
288 0.21
289 0.19
290 0.2
291 0.22
292 0.22
293 0.21
294 0.21
295 0.22
296 0.18
297 0.14
298 0.13
299 0.1
300 0.09
301 0.1
302 0.09
303 0.09
304 0.16
305 0.18
306 0.18
307 0.21
308 0.21
309 0.21
310 0.22
311 0.25
312 0.25
313 0.24
314 0.25
315 0.26
316 0.26
317 0.27
318 0.28
319 0.22
320 0.17
321 0.15
322 0.15
323 0.14
324 0.14
325 0.12
326 0.12
327 0.11
328 0.1
329 0.09
330 0.09
331 0.07
332 0.07
333 0.08
334 0.07
335 0.08
336 0.08
337 0.13
338 0.16
339 0.17
340 0.17
341 0.17
342 0.17
343 0.18
344 0.18
345 0.13