Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C2X0G8

Protein Details
Accession A0A0C2X0G8    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
56-77MVPTSYPLPKRPRRPVQGYDDEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, plas 5, cyto 3, extr 2, E.R. 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR039961  Nuo9.5  
Gene Ontology GO:0016020  C:membrane  
CDD cd22903  NI9M  
Amino Acid Sequences MASLGAPFRRTYRYLQRQAHENPVIFYSVVLGTVGPVLAVAVPPIRESFGYRPAEMVPTSYPLPKRPRRPVQGYDDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.62
3 0.63
4 0.67
5 0.68
6 0.7
7 0.63
8 0.53
9 0.44
10 0.37
11 0.34
12 0.26
13 0.21
14 0.13
15 0.09
16 0.08
17 0.07
18 0.06
19 0.05
20 0.05
21 0.05
22 0.03
23 0.03
24 0.02
25 0.02
26 0.02
27 0.03
28 0.03
29 0.03
30 0.04
31 0.05
32 0.06
33 0.06
34 0.1
35 0.13
36 0.21
37 0.23
38 0.23
39 0.24
40 0.24
41 0.26
42 0.22
43 0.22
44 0.14
45 0.15
46 0.17
47 0.2
48 0.22
49 0.27
50 0.37
51 0.45
52 0.54
53 0.61
54 0.71
55 0.76
56 0.83
57 0.84