Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C2X1K1

Protein Details
Accession A0A0C2X1K1    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MTRINRCRFSRNYKNQVPLDHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14.5, mito_nucl 11.833, nucl 8, cyto_nucl 6.333
Family & Domain DBs
Amino Acid Sequences MTRINRCRFSRNYKNQVPLDTDCENGLVYTDDIGRLIQLSSKCLILHHSFHKFTKLKVQDGKILSIDTGHDAM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.76
3 0.71
4 0.66
5 0.57
6 0.53
7 0.44
8 0.37
9 0.28
10 0.25
11 0.21
12 0.15
13 0.13
14 0.08
15 0.06
16 0.06
17 0.06
18 0.06
19 0.06
20 0.06
21 0.05
22 0.05
23 0.05
24 0.07
25 0.07
26 0.09
27 0.09
28 0.1
29 0.1
30 0.1
31 0.15
32 0.15
33 0.19
34 0.24
35 0.29
36 0.31
37 0.32
38 0.41
39 0.39
40 0.37
41 0.43
42 0.42
43 0.44
44 0.49
45 0.51
46 0.5
47 0.51
48 0.52
49 0.43
50 0.39
51 0.31
52 0.24
53 0.21