Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C2WGS4

Protein Details
Accession A0A0C2WGS4   
Localization Confidence High
Confidence Score 19.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-31MSPSRPIRKQESGKEKDKKATKERKEDPAMNHydrophilic
NLS Segment(s)
PositionSequence
6-46PIRKQESGKEKDKKATKERKEDPAMNEIKTKRASNTRPPPW
50-55GRMPKR
Subcellular Location(s) nucl 24, mito 2
Family & Domain DBs
Amino Acid Sequences MSPSRPIRKQESGKEKDKKATKERKEDPAMNEIKTKRASNTRPPPWQESGRMPKRALRLIRRDHDEYLLQEEQGFNLKLENVYDLVWLLRIMTGVTEEAKRKGKSDLDDL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.78
3 0.77
4 0.76
5 0.75
6 0.75
7 0.78
8 0.77
9 0.79
10 0.8
11 0.81
12 0.8
13 0.77
14 0.7
15 0.68
16 0.62
17 0.53
18 0.52
19 0.43
20 0.41
21 0.38
22 0.36
23 0.31
24 0.37
25 0.41
26 0.46
27 0.55
28 0.58
29 0.62
30 0.65
31 0.66
32 0.62
33 0.6
34 0.53
35 0.51
36 0.53
37 0.52
38 0.52
39 0.47
40 0.46
41 0.47
42 0.49
43 0.46
44 0.43
45 0.45
46 0.49
47 0.54
48 0.56
49 0.55
50 0.5
51 0.47
52 0.41
53 0.33
54 0.31
55 0.26
56 0.2
57 0.18
58 0.16
59 0.14
60 0.16
61 0.16
62 0.09
63 0.09
64 0.1
65 0.1
66 0.11
67 0.12
68 0.09
69 0.08
70 0.09
71 0.08
72 0.08
73 0.08
74 0.07
75 0.06
76 0.06
77 0.06
78 0.05
79 0.05
80 0.06
81 0.07
82 0.1
83 0.13
84 0.16
85 0.21
86 0.29
87 0.3
88 0.31
89 0.36
90 0.4