Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C2SII1

Protein Details
Accession A0A0C2SII1    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
49-77MPVPICICKKKTKKKRKQTSQPSLNEVKEHydrophilic
NLS Segment(s)
PositionSequence
57-66KKKTKKKRKQ
Subcellular Location(s) mito 12, nucl 5, cyto 3, plas 2, pero 2, E.R. 2
Family & Domain DBs
Amino Acid Sequences MGRGASVNETRARFRVKPLHTNFFDRECSLSVGANNGLRVLGLLSPVAMPVPICICKKKTKKKRKQTSQPSLNEVKERKYRKLPAI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.46
3 0.47
4 0.55
5 0.59
6 0.65
7 0.61
8 0.66
9 0.6
10 0.55
11 0.5
12 0.41
13 0.35
14 0.27
15 0.26
16 0.21
17 0.18
18 0.14
19 0.14
20 0.15
21 0.13
22 0.12
23 0.1
24 0.09
25 0.08
26 0.07
27 0.06
28 0.05
29 0.04
30 0.04
31 0.04
32 0.04
33 0.04
34 0.04
35 0.03
36 0.03
37 0.03
38 0.06
39 0.1
40 0.11
41 0.15
42 0.18
43 0.28
44 0.39
45 0.5
46 0.59
47 0.67
48 0.76
49 0.85
50 0.93
51 0.94
52 0.95
53 0.96
54 0.96
55 0.95
56 0.9
57 0.86
58 0.81
59 0.73
60 0.7
61 0.62
62 0.58
63 0.57
64 0.57
65 0.58
66 0.61