Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C2SMJ7

Protein Details
Accession A0A0C2SMJ7    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
118-143SLRPMIKRIVRRQPPTKPKKFVQTVRHydrophilic
NLS Segment(s)
PositionSequence
114-137MKKFSLRPMIKRIVRRQPPTKPKK
Subcellular Location(s) nucl 13.5, cyto_nucl 10.5, cyto 6.5, mito 4
Family & Domain DBs
Amino Acid Sequences MHTAVATSYPTPAAFDAGRQPFSYIPFNTPQTKSVTGRKHIADDVFCPQATSIPRKTPFNRGDDEDIPLAFFMELRSASLGPSTVKPPGPISRQAAEVDDDEDLPLVKVKERMMKKFSLRPMIKRIVRRQPPTKPKKFVQTVRDLGPRSTAMMCIVPDCPYDWHVHRVW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.15
3 0.22
4 0.26
5 0.27
6 0.26
7 0.28
8 0.26
9 0.3
10 0.33
11 0.26
12 0.26
13 0.3
14 0.34
15 0.38
16 0.39
17 0.37
18 0.37
19 0.4
20 0.4
21 0.44
22 0.47
23 0.46
24 0.5
25 0.49
26 0.47
27 0.44
28 0.43
29 0.36
30 0.31
31 0.3
32 0.26
33 0.24
34 0.21
35 0.18
36 0.19
37 0.21
38 0.24
39 0.24
40 0.29
41 0.33
42 0.39
43 0.42
44 0.48
45 0.5
46 0.49
47 0.48
48 0.44
49 0.47
50 0.41
51 0.41
52 0.32
53 0.26
54 0.21
55 0.18
56 0.14
57 0.08
58 0.07
59 0.04
60 0.05
61 0.05
62 0.05
63 0.06
64 0.06
65 0.06
66 0.06
67 0.07
68 0.06
69 0.08
70 0.09
71 0.1
72 0.1
73 0.11
74 0.14
75 0.18
76 0.21
77 0.24
78 0.27
79 0.26
80 0.27
81 0.27
82 0.25
83 0.22
84 0.19
85 0.15
86 0.11
87 0.1
88 0.08
89 0.07
90 0.06
91 0.05
92 0.07
93 0.06
94 0.07
95 0.1
96 0.12
97 0.2
98 0.25
99 0.31
100 0.33
101 0.39
102 0.43
103 0.48
104 0.51
105 0.54
106 0.53
107 0.53
108 0.57
109 0.6
110 0.61
111 0.62
112 0.66
113 0.66
114 0.71
115 0.75
116 0.76
117 0.77
118 0.83
119 0.85
120 0.86
121 0.82
122 0.79
123 0.81
124 0.81
125 0.79
126 0.76
127 0.75
128 0.7
129 0.69
130 0.7
131 0.61
132 0.52
133 0.48
134 0.39
135 0.32
136 0.28
137 0.23
138 0.18
139 0.18
140 0.18
141 0.16
142 0.16
143 0.15
144 0.15
145 0.16
146 0.17
147 0.16
148 0.22
149 0.24