Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C2RWN2

Protein Details
Accession A0A0C2RWN2    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
49-74SKLYCPPKDRCKCSPRQGKHFWKAICHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, plas 7, golg 5
Family & Domain DBs
Amino Acid Sequences MCNAAVCKSSRMSMIYHSTRLKLQRWVTLRDFFFFFCFLLFFVFEIIESKLYCPPKDRCKCSPRQGKHFWKAICTLTLTSRSSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.32
3 0.36
4 0.36
5 0.36
6 0.39
7 0.43
8 0.4
9 0.4
10 0.39
11 0.41
12 0.43
13 0.47
14 0.47
15 0.49
16 0.46
17 0.4
18 0.37
19 0.3
20 0.27
21 0.22
22 0.17
23 0.1
24 0.1
25 0.08
26 0.07
27 0.07
28 0.06
29 0.05
30 0.05
31 0.05
32 0.06
33 0.06
34 0.07
35 0.06
36 0.08
37 0.12
38 0.15
39 0.15
40 0.2
41 0.27
42 0.37
43 0.46
44 0.52
45 0.57
46 0.64
47 0.73
48 0.78
49 0.82
50 0.8
51 0.81
52 0.84
53 0.86
54 0.85
55 0.83
56 0.74
57 0.67
58 0.62
59 0.55
60 0.47
61 0.4
62 0.34
63 0.3
64 0.34