Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C2X6G0

Protein Details
Accession A0A0C2X6G0   
Localization Confidence Low
Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
39-66YYVRSVAKAGRRSKKRRREGVGKWRLVEHydrophilic
NLS Segment(s)
PositionSequence
46-61KAGRRSKKRRREGVGK
Subcellular Location(s) mito 19.5, mito_nucl 13, nucl 5.5
Family & Domain DBs
Amino Acid Sequences MGSVSARQAGFRSLLNHHVDTRFKFGCERGRMECGPWRYYVRSVAKAGRRSKKRRREGVGKWRLVEMEPSDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.29
3 0.3
4 0.3
5 0.33
6 0.35
7 0.33
8 0.37
9 0.31
10 0.28
11 0.28
12 0.29
13 0.34
14 0.34
15 0.36
16 0.33
17 0.37
18 0.36
19 0.37
20 0.38
21 0.33
22 0.29
23 0.28
24 0.27
25 0.24
26 0.25
27 0.31
28 0.3
29 0.31
30 0.32
31 0.37
32 0.41
33 0.47
34 0.54
35 0.56
36 0.61
37 0.68
38 0.76
39 0.8
40 0.84
41 0.86
42 0.87
43 0.87
44 0.88
45 0.89
46 0.89
47 0.84
48 0.75
49 0.66
50 0.58
51 0.49
52 0.44