Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C2T2B5

Protein Details
Accession A0A0C2T2B5   
Localization Confidence Medium
Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
98-119LGKFEHKPVKRQPGKRPGRVQYBasic
232-257FDEYWQHRERNKRLQKKLRQEEEESSHydrophilic
NLS Segment(s)
PositionSequence
104-114KPVKRQPGKRP
Subcellular Location(s) cyto_nucl 11.5, nucl 11, cyto 10, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001357  BRCT_dom  
IPR009057  Homeobox-like_sf  
Pfam View protein in Pfam  
PF16589  BRCT_2  
CDD cd11655  rap1_myb-like  
Amino Acid Sequences MASRKRLVEDLFTDEAGKSIAFYIHESVKEEKREKVIKAIEKHGGEVVDTDVGVDTVVVDPWYPAACTLQNKYKVHSNQSYWRTTVEGTEFVFNCIKLGKFEHKPVKRQPGKRPGRVQYTEEDDKRLCRYLAIRTPNIESGGRLGHRIYEELVDLGTLDPKEYGWALRHPPESWREHYRIKKNRSRLDAMIREYVPKLNPTEEQLYPFDRRLNRSWPSEYNERKEPHPQENFDEYWQHRERNKRLQKKLRQEEEESSDEEPEAESSDEEYQGPRYFFIYPRTPRFNATAAPSLALTRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.26
3 0.2
4 0.16
5 0.09
6 0.08
7 0.1
8 0.1
9 0.12
10 0.15
11 0.19
12 0.2
13 0.23
14 0.28
15 0.33
16 0.4
17 0.41
18 0.42
19 0.47
20 0.52
21 0.5
22 0.54
23 0.56
24 0.56
25 0.58
26 0.6
27 0.59
28 0.53
29 0.53
30 0.46
31 0.37
32 0.29
33 0.24
34 0.19
35 0.12
36 0.11
37 0.1
38 0.08
39 0.07
40 0.07
41 0.06
42 0.05
43 0.04
44 0.05
45 0.05
46 0.05
47 0.05
48 0.06
49 0.07
50 0.06
51 0.06
52 0.09
53 0.12
54 0.16
55 0.21
56 0.29
57 0.37
58 0.38
59 0.4
60 0.47
61 0.48
62 0.52
63 0.54
64 0.52
65 0.52
66 0.58
67 0.58
68 0.5
69 0.46
70 0.39
71 0.33
72 0.3
73 0.23
74 0.19
75 0.16
76 0.2
77 0.19
78 0.2
79 0.21
80 0.18
81 0.16
82 0.15
83 0.14
84 0.11
85 0.15
86 0.2
87 0.23
88 0.32
89 0.42
90 0.46
91 0.53
92 0.6
93 0.67
94 0.69
95 0.73
96 0.75
97 0.76
98 0.8
99 0.82
100 0.82
101 0.78
102 0.78
103 0.73
104 0.65
105 0.58
106 0.56
107 0.54
108 0.45
109 0.41
110 0.32
111 0.31
112 0.31
113 0.29
114 0.21
115 0.16
116 0.18
117 0.22
118 0.29
119 0.32
120 0.32
121 0.31
122 0.33
123 0.33
124 0.32
125 0.25
126 0.18
127 0.13
128 0.14
129 0.13
130 0.12
131 0.11
132 0.1
133 0.11
134 0.11
135 0.1
136 0.08
137 0.08
138 0.07
139 0.07
140 0.05
141 0.05
142 0.05
143 0.06
144 0.05
145 0.05
146 0.05
147 0.05
148 0.06
149 0.06
150 0.07
151 0.08
152 0.11
153 0.14
154 0.19
155 0.21
156 0.2
157 0.24
158 0.28
159 0.31
160 0.33
161 0.36
162 0.36
163 0.43
164 0.51
165 0.58
166 0.62
167 0.67
168 0.69
169 0.73
170 0.76
171 0.74
172 0.71
173 0.65
174 0.65
175 0.62
176 0.58
177 0.53
178 0.46
179 0.41
180 0.36
181 0.34
182 0.26
183 0.22
184 0.2
185 0.17
186 0.18
187 0.2
188 0.24
189 0.22
190 0.24
191 0.24
192 0.27
193 0.27
194 0.27
195 0.29
196 0.28
197 0.32
198 0.33
199 0.39
200 0.4
201 0.43
202 0.47
203 0.46
204 0.49
205 0.54
206 0.56
207 0.54
208 0.57
209 0.54
210 0.52
211 0.57
212 0.57
213 0.56
214 0.57
215 0.54
216 0.53
217 0.56
218 0.55
219 0.47
220 0.48
221 0.4
222 0.41
223 0.42
224 0.41
225 0.4
226 0.49
227 0.55
228 0.6
229 0.69
230 0.7
231 0.78
232 0.83
233 0.89
234 0.9
235 0.92
236 0.91
237 0.87
238 0.82
239 0.78
240 0.73
241 0.65
242 0.56
243 0.46
244 0.37
245 0.3
246 0.25
247 0.18
248 0.12
249 0.11
250 0.1
251 0.09
252 0.11
253 0.12
254 0.13
255 0.13
256 0.14
257 0.16
258 0.19
259 0.2
260 0.18
261 0.18
262 0.21
263 0.24
264 0.3
265 0.36
266 0.4
267 0.48
268 0.55
269 0.55
270 0.55
271 0.56
272 0.53
273 0.47
274 0.46
275 0.44
276 0.37
277 0.37
278 0.34