Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C2X1Y3

Protein Details
Accession A0A0C2X1Y3    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
55-77GRNRNPVKVAKRPHRWIEEKQPSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 10, plas 7, golg 4, E.R. 3, extr 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR031459  Coa2  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0033617  P:mitochondrial cytochrome c oxidase assembly  
Pfam View protein in Pfam  
PF17051  COA2  
Amino Acid Sequences MLSNSLKSSKRTFVSTLFGITFFASMLTVSASNLLPCPARTDKSRFADSDMEQSGRNRNPVKVAKRPHRWIEEKQPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.37
3 0.35
4 0.28
5 0.25
6 0.22
7 0.19
8 0.15
9 0.09
10 0.08
11 0.06
12 0.05
13 0.05
14 0.05
15 0.05
16 0.05
17 0.06
18 0.06
19 0.06
20 0.07
21 0.07
22 0.07
23 0.07
24 0.12
25 0.13
26 0.15
27 0.18
28 0.25
29 0.32
30 0.36
31 0.39
32 0.34
33 0.36
34 0.39
35 0.36
36 0.36
37 0.3
38 0.26
39 0.24
40 0.25
41 0.29
42 0.26
43 0.32
44 0.29
45 0.28
46 0.36
47 0.44
48 0.5
49 0.52
50 0.6
51 0.64
52 0.72
53 0.79
54 0.79
55 0.8
56 0.79
57 0.79