Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B2VT56

Protein Details
Accession B2VT56    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
47-73TYPSKVTRRMSKNKQAKKSKVKPFVKQHydrophilic
NLS Segment(s)
PositionSequence
55-67RMSKNKQAKKSKV
Subcellular Location(s) mito 21, nucl 4.5, cyto_nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR005824  KOW  
IPR041991  KOW_RPL27  
IPR038655  L27e_sf  
IPR001141  Ribosomal_L27e  
IPR008991  Translation_prot_SH3-like_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01777  Ribosomal_L27e  
CDD cd06090  KOW_RPL27  
Amino Acid Sequences MKFLKVGRVVIITRGRYAGKKCVIISPLDNGTKSHPFPHALVAGIETYPSKVTRRMSKNKQAKKSKVKPFVKQVNYTHIMPTRYTIELENLKGVISADTFKEVSQREEAKKTVKKAFEERYQSGKNRWFFTPLQF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.33
3 0.33
4 0.37
5 0.38
6 0.37
7 0.39
8 0.39
9 0.42
10 0.41
11 0.39
12 0.36
13 0.32
14 0.33
15 0.31
16 0.3
17 0.25
18 0.28
19 0.31
20 0.3
21 0.28
22 0.25
23 0.25
24 0.26
25 0.29
26 0.25
27 0.2
28 0.19
29 0.17
30 0.15
31 0.12
32 0.11
33 0.08
34 0.07
35 0.07
36 0.09
37 0.09
38 0.13
39 0.17
40 0.26
41 0.35
42 0.45
43 0.53
44 0.62
45 0.71
46 0.76
47 0.82
48 0.82
49 0.83
50 0.84
51 0.85
52 0.84
53 0.85
54 0.82
55 0.78
56 0.78
57 0.78
58 0.71
59 0.68
60 0.6
61 0.57
62 0.54
63 0.49
64 0.42
65 0.36
66 0.32
67 0.25
68 0.25
69 0.21
70 0.18
71 0.18
72 0.16
73 0.17
74 0.19
75 0.19
76 0.18
77 0.15
78 0.14
79 0.14
80 0.13
81 0.09
82 0.07
83 0.08
84 0.07
85 0.1
86 0.1
87 0.1
88 0.15
89 0.15
90 0.17
91 0.23
92 0.29
93 0.31
94 0.35
95 0.38
96 0.43
97 0.48
98 0.52
99 0.53
100 0.52
101 0.54
102 0.58
103 0.64
104 0.64
105 0.66
106 0.64
107 0.65
108 0.66
109 0.65
110 0.64
111 0.63
112 0.6
113 0.55
114 0.53
115 0.5