Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C2WS63

Protein Details
Accession A0A0C2WS63   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
5-24VNIRSRTKLRRLKQYAVNSNHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19, cyto 6
Family & Domain DBs
Amino Acid Sequences MQNAVNIRSRTKLRRLKQYAVNSNISGLVKTGKPGVLVFDGTRESIKTFLENARMVKFCVQGVDLGLGPVSRYLDFHHVDTSPLPRFVVLRLN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.73
3 0.75
4 0.77
5 0.81
6 0.79
7 0.75
8 0.71
9 0.6
10 0.52
11 0.47
12 0.38
13 0.27
14 0.18
15 0.15
16 0.11
17 0.12
18 0.13
19 0.1
20 0.11
21 0.11
22 0.13
23 0.11
24 0.12
25 0.11
26 0.11
27 0.11
28 0.11
29 0.11
30 0.09
31 0.08
32 0.08
33 0.09
34 0.08
35 0.09
36 0.1
37 0.14
38 0.16
39 0.17
40 0.19
41 0.19
42 0.19
43 0.2
44 0.2
45 0.16
46 0.15
47 0.14
48 0.11
49 0.11
50 0.12
51 0.09
52 0.08
53 0.08
54 0.07
55 0.06
56 0.07
57 0.08
58 0.06
59 0.07
60 0.1
61 0.16
62 0.18
63 0.2
64 0.22
65 0.2
66 0.22
67 0.24
68 0.27
69 0.25
70 0.24
71 0.23
72 0.21
73 0.22