Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B2W5P4

Protein Details
Accession B2W5P4    Localization Confidence Low Confidence Score 6.2
NoLS Segment(s)
PositionSequenceProtein Nature
59-79VEYPKTKEQMRKERRPEKGYYBasic
NLS Segment(s)
Subcellular Location(s) mito 19, nucl 3.5, cyto_nucl 3.5, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036919  L30_ferredoxin-like_sf  
IPR005996  Ribosomal_L30_bac-type  
IPR016082  Ribosomal_L30_ferredoxin-like  
Gene Ontology GO:0015934  C:large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00327  Ribosomal_L30  
CDD cd01658  Ribosomal_L30  
Amino Acid Sequences MPYFRITLMRSGIGMPQKTQGVLHALGLRKRMTTVYHPVSQSVAGQIMRIKELVDVKEVEYPKTKEQMRKERRPEKGYYVEMRAGEAMGVLE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.23
3 0.24
4 0.24
5 0.24
6 0.23
7 0.2
8 0.18
9 0.17
10 0.18
11 0.19
12 0.21
13 0.23
14 0.25
15 0.24
16 0.2
17 0.2
18 0.2
19 0.18
20 0.2
21 0.27
22 0.29
23 0.33
24 0.33
25 0.32
26 0.31
27 0.29
28 0.24
29 0.16
30 0.13
31 0.08
32 0.09
33 0.09
34 0.09
35 0.09
36 0.09
37 0.08
38 0.09
39 0.12
40 0.12
41 0.12
42 0.13
43 0.13
44 0.18
45 0.19
46 0.19
47 0.22
48 0.24
49 0.25
50 0.32
51 0.35
52 0.38
53 0.47
54 0.57
55 0.62
56 0.69
57 0.77
58 0.79
59 0.84
60 0.83
61 0.78
62 0.76
63 0.74
64 0.7
65 0.64
66 0.6
67 0.55
68 0.49
69 0.45
70 0.36
71 0.28
72 0.21