Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C2WMH8

Protein Details
Accession A0A0C2WMH8    Localization Confidence High Confidence Score 15.6
NoLS Segment(s)
PositionSequenceProtein Nature
23-44ASQARIKKIPSKKPNGKTQTKFHydrophilic
NLS Segment(s)
PositionSequence
27-38RIKKIPSKKPNG
86-86K
Subcellular Location(s) nucl 20.5, cyto_nucl 12, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR002675  Ribosomal_L38e  
IPR038464  Ribosomal_L38e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01781  Ribosomal_L38e  
Amino Acid Sequences MGYQPKEIRNIKEFIAITQRKDASQARIKKIPSKKPNGKTQTKFKVRCSRYLYTLSVDDPEKAEKLKQSLPPGLTVQEVDKPAPKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.41
3 0.37
4 0.34
5 0.39
6 0.39
7 0.31
8 0.36
9 0.37
10 0.34
11 0.41
12 0.46
13 0.46
14 0.5
15 0.52
16 0.56
17 0.61
18 0.63
19 0.64
20 0.67
21 0.7
22 0.72
23 0.81
24 0.81
25 0.82
26 0.77
27 0.78
28 0.77
29 0.77
30 0.74
31 0.72
32 0.74
33 0.66
34 0.68
35 0.65
36 0.58
37 0.52
38 0.53
39 0.46
40 0.38
41 0.37
42 0.29
43 0.25
44 0.22
45 0.18
46 0.15
47 0.15
48 0.14
49 0.14
50 0.15
51 0.16
52 0.2
53 0.26
54 0.3
55 0.35
56 0.4
57 0.4
58 0.41
59 0.39
60 0.36
61 0.31
62 0.27
63 0.23
64 0.22
65 0.23
66 0.21
67 0.26