Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C2SXM6

Protein Details
Accession A0A0C2SXM6    Localization Confidence High Confidence Score 15.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-25LNQDQQPPKKKHKTSKIINPKKDEVHydrophilic
37-56AYSRYRHPEKWKFNKARQNWHydrophilic
NLS Segment(s)
PositionSequence
9-13KKKHK
Subcellular Location(s) nucl 21, cyto_nucl 12.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR019327  WKF  
Pfam View protein in Pfam  
PF10180  WKF  
Amino Acid Sequences LNQDQQPPKKKHKTSKIINPKKDEVLSEQALKALAYAYSRYRHPEKWKFNKARQNWITRNVWSASMIPDQHLPLVTWYLKSVKGGVRD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.91
3 0.91
4 0.91
5 0.9
6 0.86
7 0.79
8 0.74
9 0.65
10 0.55
11 0.49
12 0.45
13 0.39
14 0.34
15 0.29
16 0.25
17 0.24
18 0.21
19 0.16
20 0.1
21 0.07
22 0.06
23 0.08
24 0.1
25 0.12
26 0.13
27 0.18
28 0.21
29 0.26
30 0.35
31 0.44
32 0.52
33 0.6
34 0.7
35 0.73
36 0.78
37 0.81
38 0.76
39 0.77
40 0.73
41 0.72
42 0.66
43 0.65
44 0.6
45 0.52
46 0.51
47 0.41
48 0.35
49 0.27
50 0.24
51 0.2
52 0.21
53 0.2
54 0.18
55 0.19
56 0.18
57 0.18
58 0.18
59 0.15
60 0.13
61 0.17
62 0.17
63 0.15
64 0.17
65 0.19
66 0.19
67 0.2
68 0.23