Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C2WGL5

Protein Details
Accession A0A0C2WGL5   
Localization Confidence High
Confidence Score 15.1
NoLS Segment(s)
PositionSequenceProtein Nature
52-81ALPARRASAKRRCTPSRKGKLNKKEESENEHydrophilic
84-105DIPVPSAPKKPRKKLVYVSVSEHydrophilic
NLS Segment(s)
PositionSequence
30-75SRQAKKAALEKAVWKPKKRPAIALPARRASAKRRCTPSRKGKLNKK
91-96PKKPRK
Subcellular Location(s) nucl 10.5, plas 9, cyto_nucl 8.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR045341  DUF6532  
Pfam View protein in Pfam  
PF20149  DUF6532  
Amino Acid Sequences MPRIVPKSTKGNATDTASVEEDPTISSRPSRQAKKAALEKAVWKPKKRPAIALPARRASAKRRCTPSRKGKLNKKEESENEPVDIPVPSAPKKPRKKLVYVSVSEDSNSEVSVSESDSSEAVGEDDDIENVFNDGDATEPDIQANEGGINLDDVAVTALARRVLAERPQWASQSEGDAVANGLFEDDSGSDPESPSASLAANKENIPPAPLALSPSPPPPPPPTPTPLPEVSNTQWPYYAQLNYHQTNSGLDLGLSRQHHEIKLVVRRAIETITERIIFEDAFPAPAKRTAWIFSALLAAVKFVCEIPGVPQNRYERLRARIVQDPQFVQELSTMINPRVPLLRSQIKTLAVNNAKRVYDLQDMDANGIAALVNDLKFIFPFNQHGNVQGTKPYESAAIISTIRDFLFHNSTVRIELYPERFLAGEEANHALTPSVIALAATAVTAAIEEWRTGRRIVGTFTTNVYADVYRTHLAVLTRIHDENVQGYSALLRRLYLAAASLSNLPVSPSNGMDTTLIPGSSFLDTTNMALEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.43
3 0.42
4 0.36
5 0.33
6 0.29
7 0.23
8 0.18
9 0.15
10 0.15
11 0.14
12 0.13
13 0.16
14 0.21
15 0.3
16 0.4
17 0.47
18 0.53
19 0.6
20 0.67
21 0.73
22 0.77
23 0.74
24 0.7
25 0.65
26 0.65
27 0.66
28 0.69
29 0.67
30 0.65
31 0.67
32 0.71
33 0.77
34 0.73
35 0.72
36 0.69
37 0.73
38 0.76
39 0.78
40 0.76
41 0.71
42 0.69
43 0.63
44 0.59
45 0.57
46 0.57
47 0.57
48 0.58
49 0.63
50 0.72
51 0.77
52 0.84
53 0.86
54 0.86
55 0.87
56 0.88
57 0.9
58 0.9
59 0.92
60 0.9
61 0.85
62 0.84
63 0.79
64 0.76
65 0.73
66 0.64
67 0.55
68 0.47
69 0.4
70 0.32
71 0.26
72 0.19
73 0.15
74 0.17
75 0.18
76 0.25
77 0.34
78 0.43
79 0.53
80 0.62
81 0.69
82 0.72
83 0.79
84 0.8
85 0.82
86 0.81
87 0.74
88 0.71
89 0.64
90 0.57
91 0.48
92 0.39
93 0.3
94 0.2
95 0.17
96 0.11
97 0.08
98 0.08
99 0.09
100 0.1
101 0.09
102 0.09
103 0.1
104 0.09
105 0.09
106 0.08
107 0.08
108 0.07
109 0.06
110 0.05
111 0.06
112 0.06
113 0.06
114 0.06
115 0.06
116 0.06
117 0.06
118 0.06
119 0.04
120 0.04
121 0.04
122 0.05
123 0.05
124 0.08
125 0.09
126 0.09
127 0.1
128 0.1
129 0.1
130 0.09
131 0.09
132 0.06
133 0.05
134 0.05
135 0.05
136 0.05
137 0.05
138 0.05
139 0.04
140 0.04
141 0.04
142 0.04
143 0.04
144 0.04
145 0.05
146 0.06
147 0.06
148 0.06
149 0.08
150 0.11
151 0.16
152 0.19
153 0.22
154 0.26
155 0.28
156 0.29
157 0.27
158 0.27
159 0.23
160 0.22
161 0.19
162 0.15
163 0.13
164 0.12
165 0.12
166 0.09
167 0.08
168 0.05
169 0.05
170 0.03
171 0.03
172 0.04
173 0.04
174 0.05
175 0.06
176 0.07
177 0.08
178 0.08
179 0.09
180 0.08
181 0.08
182 0.07
183 0.07
184 0.07
185 0.09
186 0.1
187 0.12
188 0.13
189 0.14
190 0.15
191 0.16
192 0.16
193 0.15
194 0.13
195 0.11
196 0.11
197 0.11
198 0.12
199 0.11
200 0.13
201 0.13
202 0.15
203 0.18
204 0.17
205 0.2
206 0.22
207 0.26
208 0.28
209 0.31
210 0.33
211 0.34
212 0.36
213 0.38
214 0.34
215 0.32
216 0.3
217 0.3
218 0.27
219 0.3
220 0.29
221 0.25
222 0.23
223 0.21
224 0.23
225 0.21
226 0.21
227 0.14
228 0.19
229 0.24
230 0.25
231 0.26
232 0.23
233 0.2
234 0.19
235 0.2
236 0.15
237 0.09
238 0.08
239 0.07
240 0.07
241 0.11
242 0.11
243 0.11
244 0.12
245 0.14
246 0.14
247 0.15
248 0.17
249 0.18
250 0.24
251 0.25
252 0.25
253 0.23
254 0.24
255 0.24
256 0.21
257 0.18
258 0.13
259 0.12
260 0.12
261 0.12
262 0.12
263 0.11
264 0.11
265 0.1
266 0.08
267 0.09
268 0.07
269 0.08
270 0.08
271 0.08
272 0.09
273 0.11
274 0.11
275 0.1
276 0.12
277 0.12
278 0.14
279 0.16
280 0.15
281 0.13
282 0.14
283 0.12
284 0.12
285 0.1
286 0.08
287 0.05
288 0.05
289 0.05
290 0.04
291 0.05
292 0.04
293 0.04
294 0.07
295 0.14
296 0.16
297 0.16
298 0.21
299 0.24
300 0.29
301 0.31
302 0.33
303 0.32
304 0.35
305 0.41
306 0.39
307 0.4
308 0.42
309 0.45
310 0.46
311 0.43
312 0.39
313 0.34
314 0.32
315 0.28
316 0.21
317 0.17
318 0.12
319 0.1
320 0.12
321 0.11
322 0.1
323 0.12
324 0.12
325 0.12
326 0.15
327 0.14
328 0.14
329 0.2
330 0.28
331 0.28
332 0.3
333 0.33
334 0.32
335 0.33
336 0.32
337 0.35
338 0.33
339 0.34
340 0.36
341 0.36
342 0.34
343 0.33
344 0.33
345 0.28
346 0.28
347 0.26
348 0.24
349 0.23
350 0.23
351 0.23
352 0.22
353 0.17
354 0.11
355 0.1
356 0.08
357 0.04
358 0.05
359 0.05
360 0.05
361 0.05
362 0.05
363 0.05
364 0.06
365 0.07
366 0.09
367 0.09
368 0.14
369 0.17
370 0.22
371 0.22
372 0.25
373 0.28
374 0.28
375 0.27
376 0.27
377 0.26
378 0.22
379 0.22
380 0.19
381 0.16
382 0.14
383 0.15
384 0.11
385 0.12
386 0.11
387 0.11
388 0.11
389 0.11
390 0.11
391 0.11
392 0.11
393 0.12
394 0.17
395 0.18
396 0.19
397 0.19
398 0.2
399 0.2
400 0.21
401 0.17
402 0.15
403 0.2
404 0.22
405 0.23
406 0.22
407 0.22
408 0.2
409 0.2
410 0.2
411 0.16
412 0.12
413 0.12
414 0.14
415 0.13
416 0.13
417 0.13
418 0.1
419 0.09
420 0.08
421 0.06
422 0.05
423 0.05
424 0.04
425 0.04
426 0.05
427 0.05
428 0.04
429 0.04
430 0.03
431 0.03
432 0.03
433 0.03
434 0.05
435 0.05
436 0.06
437 0.08
438 0.11
439 0.13
440 0.13
441 0.15
442 0.18
443 0.2
444 0.23
445 0.27
446 0.27
447 0.27
448 0.29
449 0.29
450 0.24
451 0.23
452 0.21
453 0.17
454 0.14
455 0.14
456 0.16
457 0.15
458 0.15
459 0.14
460 0.15
461 0.15
462 0.19
463 0.2
464 0.19
465 0.22
466 0.23
467 0.24
468 0.22
469 0.23
470 0.22
471 0.2
472 0.18
473 0.13
474 0.13
475 0.16
476 0.17
477 0.18
478 0.16
479 0.14
480 0.16
481 0.17
482 0.17
483 0.14
484 0.13
485 0.12
486 0.12
487 0.13
488 0.13
489 0.13
490 0.13
491 0.12
492 0.12
493 0.13
494 0.15
495 0.16
496 0.15
497 0.18
498 0.18
499 0.19
500 0.19
501 0.18
502 0.18
503 0.18
504 0.17
505 0.13
506 0.13
507 0.14
508 0.15
509 0.14
510 0.11
511 0.12
512 0.13
513 0.13