Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C2WNI1

Protein Details
Accession A0A0C2WNI1   
Localization Confidence Medium
Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
49-87YKAVEKDEETRRNRRKEKKERDRERKRQKAEAKARQRELBasic
180-206EEKYTPTSSRPRKKRVAVRKGWKGWVEHydrophilic
NLS Segment(s)
PositionSequence
59-84RRNRRKEKKERDRERKRQKAEAKARQ
189-202RPRKKRVAVRKGWK
Subcellular Location(s) mito 19, nucl 6
Family & Domain DBs
Amino Acid Sequences MALLGLLHTPMFNPAKRMRRTATAVMAGAFDVRPPRDVLTSLLNGVGPYKAVEKDEETRRNRRKEKKERDRERKRQKAEAKARQRELVGEVKSEVVSNVQIPSASAPPKAQTSTTSASSFWRARPAIHIATMQRSVSVTPPPPSTPPPLASTSTSTPAPTTSVGTSRTSSKRPFTPDEEEEKYTPTSSRPRKKRVAVRKGWKGWVEGSPPPSEKLINLDAMPVIQERRTRSGRVLGNGSPEKDNWV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.43
3 0.48
4 0.54
5 0.52
6 0.55
7 0.61
8 0.6
9 0.58
10 0.52
11 0.49
12 0.42
13 0.38
14 0.3
15 0.24
16 0.17
17 0.12
18 0.13
19 0.13
20 0.14
21 0.15
22 0.17
23 0.18
24 0.2
25 0.21
26 0.22
27 0.23
28 0.22
29 0.21
30 0.19
31 0.17
32 0.16
33 0.14
34 0.08
35 0.08
36 0.1
37 0.11
38 0.12
39 0.14
40 0.17
41 0.25
42 0.34
43 0.42
44 0.46
45 0.55
46 0.63
47 0.71
48 0.77
49 0.8
50 0.82
51 0.84
52 0.9
53 0.91
54 0.93
55 0.94
56 0.96
57 0.96
58 0.96
59 0.96
60 0.95
61 0.9
62 0.88
63 0.85
64 0.85
65 0.85
66 0.84
67 0.83
68 0.82
69 0.78
70 0.71
71 0.62
72 0.53
73 0.46
74 0.42
75 0.32
76 0.24
77 0.21
78 0.19
79 0.19
80 0.18
81 0.14
82 0.08
83 0.07
84 0.07
85 0.07
86 0.07
87 0.06
88 0.06
89 0.08
90 0.1
91 0.11
92 0.11
93 0.11
94 0.12
95 0.14
96 0.15
97 0.14
98 0.12
99 0.17
100 0.19
101 0.21
102 0.2
103 0.19
104 0.19
105 0.23
106 0.23
107 0.19
108 0.21
109 0.19
110 0.19
111 0.21
112 0.25
113 0.21
114 0.21
115 0.22
116 0.18
117 0.2
118 0.21
119 0.18
120 0.13
121 0.13
122 0.12
123 0.11
124 0.14
125 0.14
126 0.15
127 0.17
128 0.18
129 0.2
130 0.22
131 0.25
132 0.25
133 0.24
134 0.26
135 0.27
136 0.27
137 0.27
138 0.28
139 0.25
140 0.25
141 0.23
142 0.19
143 0.17
144 0.15
145 0.15
146 0.12
147 0.12
148 0.11
149 0.13
150 0.15
151 0.17
152 0.18
153 0.23
154 0.26
155 0.29
156 0.32
157 0.35
158 0.38
159 0.42
160 0.47
161 0.46
162 0.5
163 0.5
164 0.53
165 0.53
166 0.51
167 0.45
168 0.42
169 0.37
170 0.3
171 0.26
172 0.23
173 0.29
174 0.36
175 0.46
176 0.53
177 0.61
178 0.7
179 0.78
180 0.84
181 0.85
182 0.86
183 0.86
184 0.87
185 0.89
186 0.86
187 0.83
188 0.75
189 0.66
190 0.58
191 0.53
192 0.48
193 0.42
194 0.39
195 0.37
196 0.36
197 0.35
198 0.33
199 0.28
200 0.24
201 0.25
202 0.24
203 0.22
204 0.2
205 0.2
206 0.18
207 0.17
208 0.18
209 0.14
210 0.13
211 0.14
212 0.18
213 0.22
214 0.3
215 0.34
216 0.36
217 0.39
218 0.46
219 0.48
220 0.5
221 0.51
222 0.45
223 0.51
224 0.53
225 0.51
226 0.45