Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C2X034

Protein Details
Accession A0A0C2X034    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
63-89LEAQNIPKKDWPKKPCRPLRRNLEAEFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, cyto_nucl 11, pero 3, cyto 2.5
Family & Domain DBs
Amino Acid Sequences DDFEAAVRDQKERRENMVAERERNKELRASKRDAKAAMEARWEEMKREHEKAVEEWQQGCQALEAQNIPKKDWPKKPCRPLRRNLEAEF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.48
3 0.51
4 0.58
5 0.55
6 0.53
7 0.55
8 0.53
9 0.5
10 0.5
11 0.43
12 0.39
13 0.42
14 0.46
15 0.46
16 0.5
17 0.54
18 0.57
19 0.59
20 0.54
21 0.48
22 0.45
23 0.42
24 0.36
25 0.32
26 0.27
27 0.26
28 0.28
29 0.26
30 0.21
31 0.2
32 0.25
33 0.25
34 0.28
35 0.27
36 0.24
37 0.26
38 0.27
39 0.31
40 0.31
41 0.29
42 0.27
43 0.27
44 0.27
45 0.25
46 0.23
47 0.16
48 0.12
49 0.12
50 0.13
51 0.13
52 0.17
53 0.21
54 0.22
55 0.23
56 0.26
57 0.33
58 0.41
59 0.49
60 0.54
61 0.62
62 0.71
63 0.81
64 0.86
65 0.9
66 0.9
67 0.9
68 0.9
69 0.9