Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B2VS16

Protein Details
Accession B2VS16    Localization Confidence High Confidence Score 16
NoLS Segment(s)
PositionSequenceProtein Nature
111-134GIWTPQLASKRRKRRAYGHLDLSRHydrophilic
NLS Segment(s)
PositionSequence
120-125KRRKRR
Subcellular Location(s) nucl 20, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR034751  Yippee  
IPR004910  Yippee/Mis18/Cereblon  
IPR039058  Yippee_fam  
Gene Ontology GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF03226  Yippee-Mis18  
PROSITE View protein in PROSITE  
PS51792  YIPPEE  
Amino Acid Sequences MSATGWSDGSLPNTLTHKAQPRQLVTGAHTVSDISCRSCGSVLGWKYVDAAEDSQKYKVGKYILETKRIVKGAEWEQDMEEEDNGMVNETKDEDVEFDSQDEDECEDLFSGIWTPQLASKRRKRRAYGHLDLSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.22
3 0.27
4 0.33
5 0.36
6 0.41
7 0.45
8 0.45
9 0.47
10 0.48
11 0.44
12 0.38
13 0.4
14 0.35
15 0.28
16 0.24
17 0.21
18 0.18
19 0.18
20 0.16
21 0.11
22 0.11
23 0.11
24 0.12
25 0.12
26 0.12
27 0.11
28 0.18
29 0.18
30 0.21
31 0.21
32 0.2
33 0.2
34 0.2
35 0.18
36 0.12
37 0.12
38 0.12
39 0.14
40 0.16
41 0.15
42 0.18
43 0.18
44 0.17
45 0.19
46 0.17
47 0.15
48 0.17
49 0.27
50 0.27
51 0.32
52 0.33
53 0.31
54 0.34
55 0.34
56 0.31
57 0.21
58 0.23
59 0.23
60 0.26
61 0.25
62 0.21
63 0.2
64 0.2
65 0.21
66 0.16
67 0.11
68 0.07
69 0.06
70 0.06
71 0.06
72 0.06
73 0.05
74 0.05
75 0.05
76 0.07
77 0.07
78 0.07
79 0.07
80 0.07
81 0.09
82 0.1
83 0.1
84 0.09
85 0.1
86 0.1
87 0.1
88 0.09
89 0.08
90 0.07
91 0.07
92 0.07
93 0.07
94 0.07
95 0.07
96 0.07
97 0.07
98 0.07
99 0.07
100 0.07
101 0.08
102 0.12
103 0.2
104 0.26
105 0.35
106 0.46
107 0.56
108 0.66
109 0.75
110 0.79
111 0.81
112 0.85
113 0.85
114 0.85