Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C2XFV7

Protein Details
Accession A0A0C2XFV7    Localization Confidence High Confidence Score 15.4
NoLS Segment(s)
PositionSequenceProtein Nature
12-31QIKKAHRNGIKKPQRTRTRSBasic
NLS Segment(s)
PositionSequence
14-44KKAHRNGIKKPQRTRTRSLKGVDPKFRRNAK
Subcellular Location(s) nucl 20, mito 4, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MAKSKNHTNHNQIKKAHRNGIKKPQRTRTRSLKGVDPKFRRNAKYALAGSNKARLEARQAAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.78
3 0.77
4 0.74
5 0.73
6 0.74
7 0.79
8 0.78
9 0.77
10 0.77
11 0.79
12 0.81
13 0.78
14 0.77
15 0.77
16 0.75
17 0.72
18 0.66
19 0.64
20 0.63
21 0.65
22 0.67
23 0.62
24 0.61
25 0.63
26 0.67
27 0.63
28 0.58
29 0.54
30 0.49
31 0.51
32 0.47
33 0.46
34 0.44
35 0.45
36 0.42
37 0.45
38 0.41
39 0.34
40 0.33
41 0.26
42 0.3