Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C2WRC8

Protein Details
Accession A0A0C2WRC8   
Localization Confidence Low
Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
2-32QHSRLPVDARPHHRKCRKPDPQVRIPHRRVYBasic
NLS Segment(s)
Subcellular Location(s) nucl 16, cyto_nucl 10.5, mito 6, cyto 3
Family & Domain DBs
Amino Acid Sequences MQHSRLPVDARPHHRKCRKPDPQVRIPHRRVYDKSSIQWAAPCSGTGRQGKSLCQHRHRFCVVDTRLGYSVTSRSIPGERHARAISAMCSEDAVIIVVRLGQHKPVHLLIFCDNI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.82
3 0.82
4 0.85
5 0.86
6 0.86
7 0.88
8 0.86
9 0.86
10 0.89
11 0.88
12 0.87
13 0.81
14 0.78
15 0.74
16 0.72
17 0.66
18 0.62
19 0.63
20 0.57
21 0.54
22 0.53
23 0.49
24 0.41
25 0.4
26 0.34
27 0.26
28 0.22
29 0.19
30 0.14
31 0.15
32 0.2
33 0.2
34 0.21
35 0.25
36 0.26
37 0.28
38 0.32
39 0.41
40 0.43
41 0.48
42 0.55
43 0.52
44 0.57
45 0.56
46 0.51
47 0.42
48 0.45
49 0.37
50 0.35
51 0.32
52 0.3
53 0.29
54 0.28
55 0.26
56 0.17
57 0.17
58 0.12
59 0.13
60 0.1
61 0.11
62 0.13
63 0.15
64 0.19
65 0.26
66 0.25
67 0.29
68 0.29
69 0.28
70 0.27
71 0.27
72 0.23
73 0.17
74 0.17
75 0.12
76 0.12
77 0.12
78 0.11
79 0.09
80 0.08
81 0.06
82 0.05
83 0.05
84 0.06
85 0.07
86 0.09
87 0.1
88 0.15
89 0.17
90 0.19
91 0.23
92 0.26
93 0.29
94 0.27
95 0.3