Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C2S9Y3

Protein Details
Accession A0A0C2S9Y3    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MLLMKNRNKKRPSTKAKGIYILHydrophilic
NLS Segment(s)
PositionSequence
9-11KKR
Subcellular Location(s) mito 22, nucl 4
Family & Domain DBs
Amino Acid Sequences MLLMKNRNKKRPSTKAKGIYILYVRISHNKSHFHMFSFLTPQFMLFIKEISRVDMRAIIEDRNSLKASRIRKNGRPYVI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.84
3 0.83
4 0.79
5 0.69
6 0.63
7 0.54
8 0.47
9 0.38
10 0.31
11 0.27
12 0.27
13 0.28
14 0.27
15 0.29
16 0.31
17 0.32
18 0.36
19 0.35
20 0.31
21 0.31
22 0.28
23 0.25
24 0.25
25 0.23
26 0.18
27 0.17
28 0.15
29 0.13
30 0.12
31 0.13
32 0.08
33 0.09
34 0.09
35 0.12
36 0.12
37 0.14
38 0.15
39 0.14
40 0.14
41 0.17
42 0.17
43 0.17
44 0.19
45 0.17
46 0.17
47 0.2
48 0.21
49 0.21
50 0.22
51 0.18
52 0.23
53 0.27
54 0.35
55 0.41
56 0.5
57 0.54
58 0.62
59 0.72