Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B2W778

Protein Details
Accession B2W778    Localization Confidence Low Confidence Score 6.5
NoLS Segment(s)
PositionSequenceProtein Nature
201-226VQKAQRRQPTAPRRAQKKSESTPPRGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 10, extr 9, nucl 4, cyto 3
Family & Domain DBs
Amino Acid Sequences MSMCCAAAVNIPHPSRPGLAHVATTPSRPETGRGSKPSAISHCPSASYRSLRALKEPAIGCGYEICLLLGPAGRLNEPGVAAAAPKQWSVASALNYGACVQRTECPIDRGVVPSTLSLCHSVSWRNQAAGKRPRGHHRTPLWMPARYQPDASQMPSTTAHKPLPPTWLCSCDCGRGQDSAAPVRPESATALCGCRPLAAVVQKAQRRQPTAPRRAQKKSESTPPRGDPPI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.27
3 0.26
4 0.27
5 0.25
6 0.25
7 0.26
8 0.26
9 0.3
10 0.29
11 0.29
12 0.26
13 0.22
14 0.23
15 0.22
16 0.24
17 0.27
18 0.35
19 0.42
20 0.45
21 0.48
22 0.5
23 0.52
24 0.54
25 0.51
26 0.47
27 0.42
28 0.41
29 0.36
30 0.35
31 0.34
32 0.32
33 0.33
34 0.32
35 0.31
36 0.35
37 0.39
38 0.38
39 0.41
40 0.41
41 0.37
42 0.4
43 0.38
44 0.32
45 0.28
46 0.27
47 0.22
48 0.19
49 0.17
50 0.12
51 0.11
52 0.09
53 0.07
54 0.07
55 0.07
56 0.07
57 0.07
58 0.07
59 0.08
60 0.08
61 0.09
62 0.09
63 0.09
64 0.09
65 0.08
66 0.07
67 0.06
68 0.06
69 0.07
70 0.09
71 0.09
72 0.08
73 0.09
74 0.08
75 0.09
76 0.12
77 0.14
78 0.13
79 0.13
80 0.14
81 0.13
82 0.14
83 0.14
84 0.11
85 0.09
86 0.08
87 0.08
88 0.1
89 0.12
90 0.17
91 0.18
92 0.18
93 0.19
94 0.19
95 0.19
96 0.18
97 0.17
98 0.14
99 0.12
100 0.11
101 0.11
102 0.1
103 0.1
104 0.1
105 0.09
106 0.09
107 0.09
108 0.12
109 0.13
110 0.18
111 0.18
112 0.18
113 0.21
114 0.24
115 0.32
116 0.38
117 0.44
118 0.44
119 0.47
120 0.56
121 0.6
122 0.61
123 0.61
124 0.57
125 0.59
126 0.55
127 0.6
128 0.55
129 0.5
130 0.47
131 0.45
132 0.45
133 0.37
134 0.36
135 0.28
136 0.3
137 0.3
138 0.3
139 0.26
140 0.21
141 0.22
142 0.23
143 0.25
144 0.21
145 0.23
146 0.23
147 0.23
148 0.26
149 0.26
150 0.33
151 0.31
152 0.34
153 0.33
154 0.37
155 0.36
156 0.36
157 0.36
158 0.32
159 0.33
160 0.31
161 0.29
162 0.26
163 0.26
164 0.24
165 0.26
166 0.26
167 0.28
168 0.26
169 0.24
170 0.24
171 0.23
172 0.21
173 0.21
174 0.17
175 0.15
176 0.15
177 0.18
178 0.16
179 0.18
180 0.17
181 0.15
182 0.14
183 0.14
184 0.19
185 0.21
186 0.24
187 0.28
188 0.36
189 0.4
190 0.44
191 0.49
192 0.51
193 0.52
194 0.55
195 0.6
196 0.63
197 0.7
198 0.75
199 0.78
200 0.8
201 0.83
202 0.85
203 0.84
204 0.83
205 0.8
206 0.81
207 0.81
208 0.79
209 0.79
210 0.76